Recombinant Full Length Human DDR2 Protein, C-Flag-tagged
Cat.No. : | DDR2-1465HFL |
Product Overview : | Recombinant Full Length Human DDR2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the discoidin domain receptor subclass of the receptor tyrosine kinase (RTKs) protein family. RTKs play a key role in the communication of cells with their microenvironment. The encoded protein is a collagen-induced receptor that activates signal transduction pathways involved in cell adhesion, proliferation, and extracellular matrix remodeling. This protein is expressed in numerous cell types and may alos be involved in wound repair and regulate tumor growth and invasiveness. Mutations in this gene are the cause of short limb-hand type spondylometaepiphyseal dysplasia. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 94.3 kDa |
AA Sequence : | MILIPRMLLVLFLLLPILSSAKAQVNPAICRYPLGMSGGQIPDEDITASSQWSESTAAKYGRLDSEEGDG AWCPEIPVEPDDLKEFLQIDLHTLHFITLVGTQGRHAGGHGIEFAPMYKINYSRDGTRWISWRNRHGKQV LDGNSNPYDIFLKDLEPPIVARFVRFIPVTDHSMNVCMRVELYGCVWLDGLVSYNAPAGQQFVLPGGSII YLNDSVYDGAVGYSMTEGLGQLTDGVSGLDDFTQTHEYHVWPGYDYVGWRNESATNGYIEIMFEFDRIRN FTTMKVHCNNMFAKGVKIFKEVQCYFRSEASEWEPNAISFPLVLDDVNPSARFVTVPLHHRMASAIKCQY HFADTWMMFSEITFQSDAAMYNNSEALPTSPMAPTTYDPMLKVDDSNTRILIGCLVAIIFILLAIIVIIL WRQFWQKMLEKASRRMLDDEMTVSLSLPSDSSMFNNNRSSSPSEQGSNSTYDRIFPLRPDYQEPSRLIRK LPEFAPGEEESGCSGVVKPVQPSGPEGVPHYAEADIVNLQGVTGGNTYSVPAVTMDLLSGKDVAVEEFPR KLLTFKEKLGEGQFGEVHLCEVEGMEKFKDKDFALDVSANQPVLVAVKMLRADANKNARNDFLKEIKIMS RLKDPNIIHLLAVCITDDPLCMITEYMENGDLNQFLSRHEPPNSSSSDVRTVSYTNLKFMATQIASGMKY LSSLNFVHRDLATRNCLVGKNYTIKIADFGMSRNLYSGDYYRIQGRAVLPIRWMSWESILLGKFTTASDV WAFGVTLWETFTFCQEQPYSQLSDEQVIENTGEFFRDQGRQTYLPQPAICPDSVYKLMLSCWRRDTKNRP SFQEIHLLLLQQGDETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Protein Kinase, Transmembrane |
Full Length : | Full L. |
Gene Name | DDR2 discoidin domain receptor tyrosine kinase 2 [ Homo sapiens (human) ] |
Official Symbol | DDR2 |
Synonyms | TKT; WRCN; MIG20a; NTRKR3; TYRO10 |
Gene ID | 4921 |
mRNA Refseq | NM_001014796.3 |
Protein Refseq | NP_001014796.1 |
MIM | 191311 |
UniProt ID | Q16832 |
◆ Recombinant Proteins | ||
DDR2-352H | Recombinant Human DDR2, His tagged | +Inquiry |
DDR2-1310H | Recombinant Human DDR2 Protein (R422-E855), GST tagged | +Inquiry |
DDR2-107H | Recombinant Human DDR2 Protein, C-His-tagged | +Inquiry |
DDR2-28310TH | Recombinant Human DDR2 Protein (22-399aa), C-His tagged | +Inquiry |
DDR2-2457H | Recombinant Human DDR2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DDR2-2172MCL | Recombinant Mouse DDR2 cell lysate | +Inquiry |
DDR2-1033HCL | Recombinant Human DDR2 cell lysate | +Inquiry |
DDR2-001HCL | Recombinant Human DDR2 cell lysate | +Inquiry |
DDR2-1017CCL | Recombinant Cynomolgus DDR2 cell lysate | +Inquiry |
DDR2-1296RCL | Recombinant Rat DDR2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DDR2 Products
Required fields are marked with *
My Review for All DDR2 Products
Required fields are marked with *
0
Inquiry Basket