Recombinant Full Length Human DDX4 Protein, C-Flag-tagged
Cat.No. : | DDX4-500HFL |
Product Overview : | Recombinant Full Length Human DDX4 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein, which is a homolog of VASA proteins in Drosophila and several other species. The gene is specifically expressed in the germ cell lineage in both sexes and functions in germ cell development. Multiple transcript variants encoding different isoforms have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 79.1 kDa |
AA Sequence : | MGDEDWEAEINPHMSSYVPIFEKDRYSGENGDNFNRTPASSSEMDDGPSRRDHFMKSGFASGRNFGNRDA GECNKRDNTSTMGGFGVGKSFGNRGFSNSRFEDGDSSGFWRESSNDCEDNPTRNRGFSKRGGYRDGNNSE ASGPYRRGGRGSFRGCRGGFGLGSPNNDLDPDECMQRTGGLFGSRRPVLSGTGNGDTSQSRSGSGSERGG YKGLNEEVITGSGKNSWKSEAEGGESSDTQGPKVTYIPPPPPEDEDSIFAHYQTGINFDKYDTILVEVSG HDAPPAILTFEEANLCQTLNNNIAKAGYTKLTPVQKYSIPIILAGRDLMACAQTGSGKTAAFLLPILAHM MHDGITASRFKELQEPECIIVAPTRELVNQIYLEARKFSFGTCVRAVVIYGGTQLGHSIRQIVQGCNILC ATPGRLMDIIGKEKIGLKQIKYLVLDEADRMLDMGFGPEMKKLISCPGMPSKEQRQTLMFSATFPEEIQR LAAEFLKSNYLFVAVGQVGGACRDVQQTVLQVGQFSKREKLVEILRNIGDERTMVFVETKKKADFIATFL CQEKISTTSIHGDREQREREQALGDFRFGKCPVLVATSVAARGLDIENVQHVINFDLPSTIDEYVHRIGR TGRCGNTGRAISFFDLESDNHLAQPLVKVLTDAQQDVPAWLEEIAFSTYIPGFSGSTRGNVFASVDTRKG KSTLNTAGFSSSQAPNPVDDESWDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | DDX4 DEAD-box helicase 4 [ Homo sapiens (human) ] |
Official Symbol | DDX4 |
Synonyms | VASA |
Gene ID | 54514 |
mRNA Refseq | NM_024415.3 |
Protein Refseq | NP_077726.1 |
MIM | 605281 |
UniProt ID | Q9NQI0 |
◆ Recombinant Proteins | ||
DDX4-468H | Recombinant Human DDX4 Protein, MYC/DDK-tagged | +Inquiry |
DDX4-457C | Recombinant Cynomolgus DDX4 Protein, His-tagged | +Inquiry |
Ddx4-2507M | Recombinant Mouse Ddx4 Protein, Myc/DDK-tagged | +Inquiry |
DDX4-203C | Recombinant Cynomolgus Monkey DDX4 Protein, His (Fc)-Avi-tagged | +Inquiry |
DDX4-001H | Recombinant Human DDX4 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DDX4-7006HCL | Recombinant Human DDX4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DDX4 Products
Required fields are marked with *
My Review for All DDX4 Products
Required fields are marked with *
0
Inquiry Basket