Recombinant Full Length Human DDX41 Protein, C-Flag-tagged
Cat.No. : | DDX41-2054HFL |
Product Overview : | Recombinant Full Length Human DDX41 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of the DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. The protein encoded by this gene is a member of the DEAD box protein family and interacts with several spliceosomal proteins. In addition, the encoded protein may recognize the bacterial second messengers cyclic di-GMP and cyclic di-AMP, resulting in the induction of genes involved in the innate immune response. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 69.7 kDa |
AA Sequence : | MEESEPERKRARTDEVPAGGSRSEAEDEDDEDYVPYVPLRQRRQLLLQKLLQRRRKGAAEEEQQDSGSEP RGDEDDIPLGPQSNVSLLDQHQHLKEKAEARKESAKEKQLKEEEKILESVAEGRALMSVKEMAKGITYDD PIKTSWTPPRYVLSMSEERHERVRKKYHILVEGDGIPPPIKSFKEMKFPAAILRGLKKKGIHHPTPIQIQ GIPTILSGRDMIGIAFTGSGKTLVFTLPVIMFCLEQEKRLPFSKREGPYGLIICPSRELARQTHGILEYY CRLLQEDSSPLLRCALCIGGMSVKEQMETIRHGVHMMVATPGRLMDLLQKKMVSLDICRYLALDEADRMI DMGFEGDIRTIFSYFKGQRQTLLFSATMPKKIQNFAKSALVKPVTINVGRAGAASLDVIQEVEYVKEEAK MVYLLECLQKTPPPVLIFAEKKADVDAIHEYLLLKGVEAVAIHGGKDQEERTKAIEAFREGKKDVLVATD VASKGLDFPAIQHVINYDMPEEIENYVHRIGRTGRSGNTGIATTFINKACDESVLMDLKALLLEAKQKVP PVLQVLHCGDESMLDIGGERGCAFCGGLGHRITDCPKLEAMQTKQVSNIGRKDYLAHSSMDF myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Full Length : | Full L. |
Gene Name | DDX41 DEAD-box helicase 41 [ Homo sapiens (human) ] |
Official Symbol | DDX41 |
Synonyms | ABS; MPLPF |
Gene ID | 51428 |
mRNA Refseq | NM_016222.4 |
Protein Refseq | NP_057306.2 |
MIM | 608170 |
UniProt ID | Q9UJV9 |
◆ Recombinant Proteins | ||
Ddx41-2508M | Recombinant Mouse Ddx41 Protein, Myc/DDK-tagged | +Inquiry |
DDX41-2054HFL | Recombinant Full Length Human DDX41 Protein, C-Flag-tagged | +Inquiry |
DDX41-0855H | Recombinant Human DDX41 Protein (M1-F622), Flag tagged | +Inquiry |
DDX41-744H | Recombinant Human DDX41 Protein, His (Fc)-Avi-tagged | +Inquiry |
DDX41-11275Z | Recombinant Zebrafish DDX41 | +Inquiry |
◆ Cell & Tissue Lysates | ||
DDX41-7005HCL | Recombinant Human DDX41 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DDX41 Products
Required fields are marked with *
My Review for All DDX41 Products
Required fields are marked with *
0
Inquiry Basket