Recombinant Full Length Human DDX49 Protein, GST-tagged

Cat.No. : DDX49-2618HF
Product Overview : Human DDX49 full-length ORF ( NP_061943.2, 1 a.a. - 483 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 483 amino acids
Description : DDX49 (DEAD-Box Helicase 49) is a Protein Coding gene. Among its related pathways are rRNA processing in the nucleus and cytosol and Gene Expression. GO annotations related to this gene include nucleic acid binding and ATP-dependent RNA helicase activity.
Molecular Mass : 80.6 kDa
AA Sequence : MAGFAELGLSSWLVEQCRQLGLKQPTPVQLGCIPAILEGRDCLGCAKTGSGKTAAFVLPILQKLSEDPYGIFCLVLTPTRELAYQIAEQFRVLGKPLGLKDCIIVGGMDMVAQALELSRKPHVVIATPGRLADHLRSSNTFSIKKIRFLVMDEADRLLEQGCTDFTVDLEAILAAVPARRQTLLFSATLTDTLRELQGLATNQPFFWEAQAPVSTVEQLDQRYLLVPEKVKDAYLVHLIQRFQDEHEDWSIIIFTNTCKTCQILCMMLRKFSFPTVALHSMMKQKERFAALAKFKSSIYRILIATDVASRGLDIPTVQVVINHNTPGLPKIYIHRVGRTARAGRQGQAITLVTQYDIHLVHAIEEQIKKKLEEFSVEEAEVLQILTQVNVVRRECEIKLEAAHFDEKKEINKRKQLILEGKDPDLEAKRKAELAKIKQKNRRFKEKVEETLKRQKAGRAGHKGRPPRTPSGSHSGPVPSQGLV
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DDX49 DEAD (Asp-Glu-Ala-Asp) box polypeptide 49 [ Homo sapiens ]
Official Symbol DDX49
Synonyms DDX49; DEAD (Asp-Glu-Ala-Asp) box polypeptide 49; probable ATP-dependent RNA helicase DDX49; FLJ10432; DEAD box protein 49; R27090_2;
Gene ID 54555
mRNA Refseq NM_019070
Protein Refseq NP_061943
UniProt ID Q9Y6V7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DDX49 Products

Required fields are marked with *

My Review for All DDX49 Products

Required fields are marked with *

0
cart-icon
0
compare icon