Recombinant Full Length Human DEC1 Protein, GST-tagged

Cat.No. : DEC1-3792HF
Product Overview : Human DEC1 full-length ORF ( AAI53140.1, 1 a.a. - 70 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 70 amino acids
Description : The function of this gene is not known. This gene is located in a region commonly deleted in esophageal squamous cell carcinomas. Gene expression is reduced or absent in these carcinomas and thus this is a candidate tumor suppressor gene for esophageal squamous cell carcinomas. [provided by RefSeq, Jul 2008]
Molecular Mass : 34.1 kDa
AA Sequence : MTMNVLEAGKWKSIVPAPGEGLLAVLHMMVFTDALHRERSVKWQAGVCYNGGKDFAVSLARPKAAEGIAD
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DEC1 deleted in esophageal cancer 1 [ Homo sapiens (human) ]
Official Symbol DEC1
Synonyms DEC1; deleted in esophageal cancer 1; CTS9; deleted in esophageal cancer 1; candidate tumor suppressor CTS9
Gene ID 50514
mRNA Refseq NM_017418
Protein Refseq NP_059114
MIM 604767
UniProt ID Q9P2X7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DEC1 Products

Required fields are marked with *

My Review for All DEC1 Products

Required fields are marked with *

0
cart-icon
0
compare icon