Recombinant Human 43070 Protein, GST-tagged

• Cat.No.: DEC1-5158H
• Product Overview: Human DEC1 full-length ORF ( AAI53140.1, 1 a.a. - 70 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The function of this gene is not known. This gene is located in a region commonly deleted in esophageal squamous cell carcinomas. Gene expression is reduced or absent in these carcinomas and thus this is a candidate tumor suppressor gene for esophageal squamous cell carcinomas. [provided by RefSeq, Jul 2008]
• Molecular Mass: 34.1 kDa
• AA Sequence: MTMNVLEAGKWKSIVPAPGEGLLAVLHMMVFTDALHRERSVKWQAGVCYNGGKDFAVSLARPKAAEGIAD
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DEC1 deleted in esophageal cancer 1 [ Homo sapiens (human) ]
• Official Symbol: DEC1
• Synonyms: DEC1; deleted in esophageal cancer 1; CTS9; deleted in esophageal cancer 1; candidate tumor suppressor CTS9
• Gene ID: 50514
• mRNA Refseq: NM_017418
• Protein Refseq: NP_059114
• MIM: 604767
• UniProt ID: Q9P2X7