Recombinant Full Length Human DECR2 Protein, GST-tagged
| Cat.No. : | DECR2-2414HF |
| Product Overview : | Human DECR2 full-length ORF ( NP_065715.1, 1 a.a. - 292 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 292 amino acids |
| Description : | DECR2 (2,4-Dienoyl-CoA Reductase 2) is a Protein Coding gene. Among its related pathways are Peroxisome and Metabolism. GO annotations related to this gene include receptor binding and 2,4-dienoyl-CoA reductase (NADPH) activity. An important paralog of this gene is PECR. |
| Molecular Mass : | 57.2 kDa |
| AA Sequence : | MAQPPPDVEGDDCLPAYRHLFCPDLLRDKVAFITGGGSGIGFRIAEIFMRHGCHTVIASRSLPRVLTAARKLAGATGRRCLPLSMDVRAPPAVMAAVDQALKEFGRIDILINCAAGNFLCPAGALSFNAFKTVMDIDTSGTFNVSRVLYEKFFRDHGGVIVNITATLGNRGQALQVHAGSAKAAVDAMTRHLAVEWGPQNIRVNSLAPGPISGTEGLRRLGGPQASLSTKVTASPLQRLGNKTEIAHSVLYLASPLASYVTGAVLVADGGAWLTFPNGVKGLPDFASFSAKL |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | DECR2 2,4-dienoyl CoA reductase 2, peroxisomal [ Homo sapiens ] |
| Official Symbol | DECR2 |
| Synonyms | DECR2; 2,4-dienoyl CoA reductase 2, peroxisomal; peroxisomal 2,4-dienoyl-CoA reductase; PDCR; SDR17C1; short chain dehydrogenase/reductase family 17C; member 1; 2,4-dienoyl-CoA reductase 2; short chain dehydrogenase/reductase family 17C, member 1; |
| Gene ID | 26063 |
| mRNA Refseq | NM_020664 |
| Protein Refseq | NP_065715 |
| MIM | 615839 |
| UniProt ID | Q9NUI1 |
| ◆ Recombinant Proteins | ||
| DECR2-1049R | Recombinant Rhesus Macaque DECR2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| DECR2-1826R | Recombinant Rat DECR2 Protein | +Inquiry |
| DECR2-1330H | Recombinant Human 2,4-Dienoyl CoA Reductase 2, Peroxisomal, His-tagged | +Inquiry |
| DECR2-27085TH | Recombinant Human DECR2, His-tagged | +Inquiry |
| DECR2-1224R | Recombinant Rhesus monkey DECR2 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DECR2-462HCL | Recombinant Human DECR2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DECR2 Products
Required fields are marked with *
My Review for All DECR2 Products
Required fields are marked with *



