Recombinant Human DECR2, His-tagged
Cat.No. : | DECR2-27085TH |
Product Overview : | Recombinant full length Human DECR2 with N terminal His tag; 315 amino acids with tag, Predicted MWt 33.2 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 292 amino acids |
Description : | Peroxisomal 2,4-dienoyl-CoA reductase is an enzyme that in humans is encoded by the DECR2 gene. |
Conjugation : | HIS |
Molecular Weight : | 33.200kDa inclusive of tags |
Form : | Liquid |
Purity : | >95% by SDS-PAGE |
Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 40% Glycerol, 0.88% Sodium chloride, 0.02% DTT |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMGSMAQPPPDVEGDDCLPAY RHLFCPDLLRDKVAFITGGGSGIGFRIAEIFMRHGCHTVI ASRSLPRVLTAARKLAGATGRRCLPLSMDVRAPPAVMAAV DQALKEFGRIDILINCAAGNFLCPAGALSFNAFKTVMDID TSGTFNVSRVLYEKFFRDHGGVIVNITATLGNRGQALQVH AGSAKAAVDAMTRHLAVEWGPQNIRVNSLAPGPISGTEGL RRLGGPQASLSTKVTASPLQRLGNKTEIAHSVLYLASPLA SYVTGAVLVADGGAWLTFPNGVKGLPDFASFSAKL |
Sequence Similarities : | Belongs to the short-chain dehydrogenases/reductases (SDR) family. 2,4-dienoyl-CoA reductase subfamily. |
Gene Name | DECR2 2,4-dienoyl CoA reductase 2, peroxisomal [ Homo sapiens ] |
Official Symbol | DECR2 |
Synonyms | DECR2; 2,4-dienoyl CoA reductase 2, peroxisomal; peroxisomal 2,4-dienoyl-CoA reductase; PDCR; SDR17C1; short chain dehydrogenase/reductase family 17C; member 1; |
Gene ID | 26063 |
mRNA Refseq | NM_020664 |
Protein Refseq | NP_065715 |
Uniprot ID | Q9NUI1 |
Chromosome Location | 16p13.3 |
Pathway | Peroxisome, organism-specific biosystem; Peroxisome, conserved biosystem; fatty acid beta-oxidation IV (unsaturated, even number), organism-specific biosystem; |
Function | 2,4-dienoyl-CoA reductase (NADPH) activity; nucleotide binding; oxidoreductase activity; |
◆ Recombinant Proteins | ||
DECR2-27085TH | Recombinant Human DECR2, His-tagged | +Inquiry |
DECR2-1484R | Recombinant Rat DECR2 Protein, His (Fc)-Avi-tagged | +Inquiry |
DECR2-2414HF | Recombinant Full Length Human DECR2 Protein, GST-tagged | +Inquiry |
DECR2-2511H | Recombinant Human DECR2 Protein, GST-tagged | +Inquiry |
DECR2-12508Z | Recombinant Zebrafish DECR2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
DECR2-462HCL | Recombinant Human DECR2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DECR2 Products
Required fields are marked with *
My Review for All DECR2 Products
Required fields are marked with *