Recombinant Full Length Human DEDD2 Protein, GST-tagged

Cat.No. : DEDD2-2418HF
Product Overview : Human DEDD2 full-length ORF ( AAH13372.2, 1 a.a. - 185 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 185 amino acids
Description : This gene encodes a nuclear-localized protein containing a death effector domain (DED). The encoded protein may regulate the trafficking of caspases and other proteins into the nucleus during death receptor-induced apoptosis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2012]
Molecular Mass : 47 kDa
AA Sequence : MALSGSTPAPCWEEDECLDYYGMLSLHRMFEVVGGQLTECELELLAFLLDEAPGAAGGLARARSGLELLLELERRGQCDESNLRLLGQLLRVLARHDLLPHLARKRRRPVSPERYSYGTSSSSKRTEGSCRRRRQSSSSANSQQGSPPTKRQRRSRGRPSGGARRRRRGAPAAPQQQSEPAQTFL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DEDD2 death effector domain containing 2 [ Homo sapiens ]
Official Symbol DEDD2
Synonyms DEDD2; death effector domain containing 2; DNA-binding death effector domain-containing protein 2; FLAME 3; DED-containing protein FLAME-3; FADD-like anti-apoptotic molecule 3; death effector domain-containing DNA binding protein 2; FLAME-3;
Gene ID 162989
mRNA Refseq NM_133328
Protein Refseq NP_579874
MIM 617078
UniProt ID Q8WXF8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DEDD2 Products

Required fields are marked with *

My Review for All DEDD2 Products

Required fields are marked with *

0
cart-icon