Recombinant Full Length Human DEF6 Protein, GST-tagged
Cat.No. : | DEF6-2421HF |
Product Overview : | Human DEF6 full-length ORF ( AAH17504, 1 a.a. - 336 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 336 amino acids |
Description : | DEF6, or IBP, is a guanine nucleotide exchange factor (GEF) for RAC (MIM 602048) and CDC42 (MIM 116952) that is highly expressed in B and T cells (Gupta et al., 2003 [PubMed 12923183]).[supplied by OMIM, Mar 2008] |
Molecular Mass : | 62.7 kDa |
AA Sequence : | MALRKELLKSIWYAFTALDVEKSGKVSKSQLKVLSHNLYTVLHIPHDPVALEEHFRDDDDGPVSSQGYMPYLNKYILDKVEEGAFVKEHFDELCWTLTAKKNYRADSNGNSMLSNQDAFRLWCLFNFLSEDKYPLIMVPDEVEYLLKKVLSSMSLEVSLGELEELLAQEAQVAQTTGGLSVWQFLELFNSGRCLRGVGRDTLSMAIHEVYQELIQDVLKQGYLWKRGHLRRNWAERWFQLQPSCLCYFGSEECKEKRGIIPLDAHCCVEVLPDRDGKRCMFCVKTATRTYEMSASDTRQRQEWTAAIQMAIRLQAEGKTSLHKDLKQKRREQREQR |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DEF6 differentially expressed in FDCP 6 homolog (mouse) [ Homo sapiens ] |
Official Symbol | DEF6 |
Synonyms | DEF6; differentially expressed in FDCP 6 homolog (mouse); differentially expressed in FDCP (mouse homolog) 6; differentially expressed in FDCP 6 homolog; IBP; SLAT; SWAP 70 like adaptor protein of T cells; SWAP70L; DEF-6; IRF4-binding protein; SWAP-70-like adaptor protein of T cells; |
Gene ID | 50619 |
mRNA Refseq | NM_022047 |
Protein Refseq | NP_071330 |
MIM | 610094 |
UniProt ID | Q9H4E7 |
◆ Recombinant Proteins | ||
DEF6-2284M | Recombinant Mouse DEF6 Protein, His (Fc)-Avi-tagged | +Inquiry |
DEF6-2421HF | Recombinant Full Length Human DEF6 Protein, GST-tagged | +Inquiry |
DEF6-4588H | Recombinant Human DEF6 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
DEF6-2516H | Recombinant Human DEF6 Protein, GST-tagged | +Inquiry |
Def6-2517M | Recombinant Mouse Def6 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DEF6-6993HCL | Recombinant Human DEF6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DEF6 Products
Required fields are marked with *
My Review for All DEF6 Products
Required fields are marked with *
0
Inquiry Basket