Recombinant Full Length Human DEFB1 Protein, GST-tagged
Cat.No. : | DEFB1-2430HF |
Product Overview : | Human DEFB1 full-length ORF ( AAH47677, 1 a.a. - 68 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 68 amino acids |
Description : | Defensins form a family of microbicidal and cytotoxic peptides made by neutrophils. Members of the defensin family are highly similar in protein sequence. This gene encodes defensin, beta 1, an antimicrobial peptide implicated in the resistance of epithelial surfaces to microbial colonization. This gene maps in close proximity to defensin family member, defensin, alpha 1 and has been implicated in the pathogenesis of cystic fibrosis. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 33.22 kDa |
AA Sequence : | MRTSYLLLFTLCLLLSEMASGGNFLTGLGHRSDHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DEFB1 defensin, beta 1 [ Homo sapiens ] |
Official Symbol | DEFB1 |
Synonyms | DEFB1; defensin, beta 1; beta-defensin 1; BD1; DEFB 1; DEFB101; HBD 1; HBD1; MGC51822; BD-1; beta-defensin-1; DEFB-1; |
Gene ID | 1672 |
mRNA Refseq | NM_005218 |
Protein Refseq | NP_005209 |
MIM | 602056 |
UniProt ID | P60022 |
◆ Recombinant Proteins | ||
DEFB1-4464M | Recombinant Mouse DEFB1 Protein | +Inquiry |
DEFB1-2300M | Recombinant Mouse DEFB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
DEFB1-27203TH | Recombinant Human DEFB1 | +Inquiry |
DEFB1-11929H | Recombinant Human DEFB1, GST-tagged | +Inquiry |
DEFB1-1829R | Recombinant Rat DEFB1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
DEFB1-6989HCL | Recombinant Human DEFB1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DEFB1 Products
Required fields are marked with *
My Review for All DEFB1 Products
Required fields are marked with *