Recombinant Full Length Human DEFB1 Protein, GST-tagged

Cat.No. : DEFB1-2430HF
Product Overview : Human DEFB1 full-length ORF ( AAH47677, 1 a.a. - 68 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 68 amino acids
Description : Defensins form a family of microbicidal and cytotoxic peptides made by neutrophils. Members of the defensin family are highly similar in protein sequence. This gene encodes defensin, beta 1, an antimicrobial peptide implicated in the resistance of epithelial surfaces to microbial colonization. This gene maps in close proximity to defensin family member, defensin, alpha 1 and has been implicated in the pathogenesis of cystic fibrosis. [provided by RefSeq, Jul 2008]
Molecular Mass : 33.22 kDa
AA Sequence : MRTSYLLLFTLCLLLSEMASGGNFLTGLGHRSDHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DEFB1 defensin, beta 1 [ Homo sapiens ]
Official Symbol DEFB1
Synonyms DEFB1; defensin, beta 1; beta-defensin 1; BD1; DEFB 1; DEFB101; HBD 1; HBD1; MGC51822; BD-1; beta-defensin-1; DEFB-1;
Gene ID 1672
mRNA Refseq NM_005218
Protein Refseq NP_005209
MIM 602056
UniProt ID P60022

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DEFB1 Products

Required fields are marked with *

My Review for All DEFB1 Products

Required fields are marked with *

0
cart-icon