Recombinant Full Length Human DEFB110 Protein, GST-tagged

Cat.No. : DEFB110-2435HF
Product Overview : Human DEFB110 full-length ORF (AAI48764.1, 1 a.a. - 62 a.a.) recombinant protein with GST tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 62 amino acids
Description : Defensins form a family of antimicrobial and cytotoxic peptides made by neutrophils. Defensins are short, processed peptide molecules that are classified by structure into three groups: alpha-defensins, beta-defensins and theta-defensins. All beta-defensin genes are densely clustered in four to five syntenic chromosomal regions. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2014]
Molecular Mass : 33.77 kDa
AA Sequence : MKIQLFFFILHFWVTILPARSNFEPKYRFERCEKVRGICKTFCDDVEYDYGYCIKWRSQCCV
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DEFB110 defensin, beta 110 locus [ Homo sapiens ]
Official Symbol DEFB110
Synonyms DEFB110; defensin, beta 110 locus; defensin, beta 110; beta-defensin 110; DEFB 10; DEFB 11; DEFB111; beta-defensin 10; beta-defensin 11; beta-defensin 111; defensin, beta 10; DEFB-10; DEFB-11; MGC183056; MGC190230;
Gene ID 245913
mRNA Refseq NM_001037497
Protein Refseq NP_001032586
UniProt ID Q30KQ9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DEFB110 Products

Required fields are marked with *

My Review for All DEFB110 Products

Required fields are marked with *

0
cart-icon
0
compare icon