Recombinant Full Length Human DEFB110 Protein, GST-tagged
| Cat.No. : | DEFB110-2435HF |
| Product Overview : | Human DEFB110 full-length ORF (AAI48764.1, 1 a.a. - 62 a.a.) recombinant protein with GST tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 62 amino acids |
| Description : | Defensins form a family of antimicrobial and cytotoxic peptides made by neutrophils. Defensins are short, processed peptide molecules that are classified by structure into three groups: alpha-defensins, beta-defensins and theta-defensins. All beta-defensin genes are densely clustered in four to five syntenic chromosomal regions. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2014] |
| Molecular Mass : | 33.77 kDa |
| AA Sequence : | MKIQLFFFILHFWVTILPARSNFEPKYRFERCEKVRGICKTFCDDVEYDYGYCIKWRSQCCV |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | DEFB110 defensin, beta 110 locus [ Homo sapiens ] |
| Official Symbol | DEFB110 |
| Synonyms | DEFB110; defensin, beta 110 locus; defensin, beta 110; beta-defensin 110; DEFB 10; DEFB 11; DEFB111; beta-defensin 10; beta-defensin 11; beta-defensin 111; defensin, beta 10; DEFB-10; DEFB-11; MGC183056; MGC190230; |
| Gene ID | 245913 |
| mRNA Refseq | NM_001037497 |
| Protein Refseq | NP_001032586 |
| UniProt ID | Q30KQ9 |
| ◆ Recombinant Proteins | ||
| DEFB110-2524H | Recombinant Human DEFB110 Protein, GST-tagged | +Inquiry |
| DEFB110-2435HF | Recombinant Full Length Human DEFB110 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DEFB110 Products
Required fields are marked with *
My Review for All DEFB110 Products
Required fields are marked with *
