Recombinant Full Length Human DEFB119 Protein, GST-tagged
Cat.No. : | DEFB119-2436HF |
Product Overview : | Human DEFB119 full-length ORF (AAH62212.1, 1 a.a. - 84 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 84 amino acids |
Description : | This gene encodes a member of the beta subfamily of defensins. Beta-defensins are antimicrobial peptides that protect tissues and organs from infection by a variety of microorganisms. This gene is found in a cluster with other beta-defensin genes on the long arm of chromosome 20. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2014] |
Molecular Mass : | 35.64 kDa |
AA Sequence : | MKLLYLFLAILLAIEEPVISGKRHILRCMGNSGICRASCKKNEQPYLYCRNCQSCCLQSYMRISISGKEENTDWSYEKQWPRLP |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DEFB119 defensin, beta 119 [ Homo sapiens ] |
Official Symbol | DEFB119 |
Synonyms | DEFB-19; DEFB-20; DEFB120; ESC42-RELA; ESC42-RELB |
Gene ID | 245932 |
mRNA Refseq | NM_173460.1 |
Protein Refseq | NP_775689.1 |
UniProt ID | Q8N690 |
◆ Recombinant Proteins | ||
DEFB119-679H | Recombinant Human DEFB119 Protein, Fc-tagged | +Inquiry |
DEFB119-1232R | Recombinant Rhesus monkey DEFB119 Protein, His-tagged | +Inquiry |
DEFB119-2525H | Recombinant Human DEFB119 Protein, GST-tagged | +Inquiry |
DEFB119-2436HF | Recombinant Full Length Human DEFB119 Protein, GST-tagged | +Inquiry |
DEFB119-1555H | Recombinant Human DEFB119 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DEFB119-6985HCL | Recombinant Human DEFB119 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DEFB119 Products
Required fields are marked with *
My Review for All DEFB119 Products
Required fields are marked with *
0
Inquiry Basket