Recombinant Full Length Human DERL3 Protein, GST-tagged

Cat.No. : DERL3-2475HF
Product Overview : Human DERL3 full-length ORF ( NP_940842.2, 1 a.a. - 205 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 205 amino acids
Description : The protein encoded by this gene belongs to the derlin family, and resides in the endoplasmic reticulum (ER). Proteins that are unfolded or misfolded in the ER must be refolded or degraded to maintain the homeostasis of the ER. This protein appears to be involved in the degradation of misfolded glycoproteins in the ER. Several alternatively spliced transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq, Oct 2008]
Molecular Mass : 49.8 kDa
AA Sequence : MAWQGLAAEFLQVPAVTRAYTAACVLTTAAVQLELLSPFQLYFNPHLVFRKFQVWRLVTNFLFFGPLGFSFFFNMLFVFRYCRMLEEGSFRGRTADFVFMFLFGGVLMTLLGLLGSLFFLGQALMAMLVYVWSRRSPRVRVNFFGLLTFQAPFLPWALMGFSLLLGNSILVDLLGIAVGHIYYFLEDVFPNQPGGKRLLQTPGFL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DERL3 Der1-like domain family, member 3 [ Homo sapiens ]
Official Symbol DERL3
Synonyms DERL3; Der1-like domain family, member 3; C22orf14, chromosome 22 open reading frame 14; derlin-3; derlin 3; FLJ43842; IZP6; MGC71803; DERtrin 3; DERtrin-3; der1-like protein 3; degradation in endoplasmic reticulum protein 3; LLN2; C22orf14;
Gene ID 91319
mRNA Refseq NM_001002862
Protein Refseq NP_001002862
MIM 610305
UniProt ID Q96Q80

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DERL3 Products

Required fields are marked with *

My Review for All DERL3 Products

Required fields are marked with *

0
cart-icon