Recombinant Full Length Human DES Protein, GST-tagged
| Cat.No. : | DES-2476HF |
| Product Overview : | Human DES full-length ORF (AAH32116.1, 1 a.a. - 470 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 470 amino acids |
| Description : | This gene encodes a muscle-specific class III intermediate filament. Homopolymers of this protein form a stable intracytoplasmic filamentous network connecting myofibrils to each other and to the plasma membrane. Mutations in this gene are associated with desmin-related myopathy, a familial cardiac and skeletal myopathy (CSM), and with distal myopathies. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 79.9 kDa |
| AA Sequence : | MSQAYSSSQRVSSYRRTFGGAPGFPLGSPLSSPVFPRAGFGSKGSSSSVTSRVYQVSRTSGGAGGLGSLRASRLGTTRTPSSYGAGELLDFSLADAVNQEFLTTRTNEKVELQELNDRFANYIEKVRFLEQQNAALAAEVNRLKGREPTRVAELYEEELRELRRQVEVLTNQRARVDVERDNLLDDLQRLKAKLQEEIQLKEEAENNLAAFRADVDAATLARIDLERRIESLNEEIAFLKKVHEEEIRELQAQLQEQQVQVEMDMSKPDLTAALRDIRAQYETIAAKNISEAEEWYKSKVSDLTQAANKNNDALRQAKQEMMEYRHQIQSYTCEIDALKGTNDSLMRQMRELEDRFASEASGYQDNIARLEEEIRHLKDEMARHLREYQDLLNVKMALDVEIATYRKLLEGEESRINLPIQTYSALNFRETSPEQRGSEVHTKKTVMIKTIETRDGEVVSEATQQQHEVL |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | DES desmin [ Homo sapiens ] |
| Official Symbol | DES |
| Synonyms | DES; desmin; CMD1I; CSM1; CSM2; intermediate filament protein; FLJ12025; FLJ39719; FLJ41013; FLJ41793; |
| Gene ID | 1674 |
| mRNA Refseq | NM_001927 |
| Protein Refseq | NP_001918 |
| MIM | 125660 |
| UniProt ID | P17661 |
| ◆ Recombinant Proteins | ||
| DES-1071R | Recombinant Rhesus Macaque DES Protein, His (Fc)-Avi-tagged | +Inquiry |
| DES-1951H | Recombinant Human DES Protein (Met1-Leu470), N-His tagged | +Inquiry |
| DES-3303H | Recombinant Human DES protein, His-tagged | +Inquiry |
| DES-4526M | Recombinant Mouse DES Protein | +Inquiry |
| DES-2337M | Recombinant Mouse DES Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Native Proteins | ||
| DES-167C | Native chicken DES | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DES-6969HCL | Recombinant Human DES 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DES Products
Required fields are marked with *
My Review for All DES Products
Required fields are marked with *
