Recombinant Human DES protein(91-460 aa), C-His-tagged
| Cat.No. : | DES-2676H |
| Product Overview : | Recombinant Human DES protein(P17661)(91-460 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 91-460 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | FSLADAVNQEFLTTRTNEKVELQELNDRFANYIEKVRFLEQQNAALAAEVNRLKGREPTRVAELYEEELRELRRQVEVLTNQRARVDVERDNLLDDLQRLKAKLQEEIQLKEEAENNLAAFRADVDAATLARIDLERRIESLNEEIAFLKKVHEEEIRELQAQLQEQQVQVEMDMSKPDLTAALRDIRAQYETIAAKNISEAEEWYKSKVSDLTQAANKNNDALRQAKQEMMEYRHQIQSYTCEIDALKGTNDSLMRQMRELEDRFASEASGYQDNIARLEEEIRHLKDEMARHLREYQDLLNVKMALDVEIATYRKLLEGEESRINLPIQTYSALNFRETSPEQRGSEVHTKKTVMIKTIETRDGEVVS |
| Gene Name | DES desmin [ Homo sapiens ] |
| Official Symbol | DES |
| Synonyms | DES; desmin; CMD1I; CSM1; CSM2; intermediate filament protein; FLJ12025; FLJ39719; FLJ41013; FLJ41793; |
| Gene ID | 1674 |
| mRNA Refseq | NM_001927 |
| Protein Refseq | NP_001918 |
| MIM | 125660 |
| UniProt ID | P17661 |
| ◆ Recombinant Proteins | ||
| DES-330H | Recombinant Human DES Protein, His-tagged | +Inquiry |
| DES-329H | Recombinant Human DES Protein, His-tagged | +Inquiry |
| DES-168H | Recombinant human DES | +Inquiry |
| DES-328H | Recombinant Human DES Protein, DDK-tagged | +Inquiry |
| DES-0978B | Recombinant Bacillus subtilis DES protein, His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| DES-167C | Native chicken DES | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| Des-012MKCL | Mouse Des Knockdown Cell Lysate | +Inquiry |
| DES-6969HCL | Recombinant Human DES 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DES Products
Required fields are marked with *
My Review for All DES Products
Required fields are marked with *



