Recombinant Full Length Human DGCR6 Protein, GST-tagged
| Cat.No. : | DGCR6-2493HF |
| Product Overview : | Human DGCR6 full-length ORF ( NP_005666.2, 1 a.a. - 220 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 220 amino acids |
| Description : | DiGeorge syndrome, and more widely, the CATCH 22 syndrome, are associated with microdeletions in chromosomal region 22q11.2. The product of this gene shares homology with the Drosophila melanogaster gonadal protein, which participates in gonadal and germ cell development, and with the gamma-1 subunit of human laminin. This gene is a candidate for involvement in DiGeorge syndrome pathology and in schizophrenia. [provided by RefSeq, Nov 2008] |
| Molecular Mass : | 51.4 kDa |
| AA Sequence : | MERYAGALEEVADGARQQERHYQLLSALQSLVKELPSSFQQRLSYTTLSDLALALLDGTVFEIVQGLLEIQHLTEKSLYNQRLRLQNEHRVLRQALRQKHQEAQQACRPHNLPVLQAAQQRELEAVEHRIREEQRAMDQKIVLELDRKVADQQSTLEKAGVAGFYVTTNPQELMLQMNLLELIRKLQQRGCWAGKAALGLGGPWQLPAAQCDQKGSPVPP |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | DGCR6 DiGeorge syndrome critical region gene 6 [ Homo sapiens ] |
| Official Symbol | DGCR6 |
| Synonyms | DGCR6; DiGeorge syndrome critical region gene 6; protein DGCR6; DiGeorge syndrome critical region protein 6; |
| Gene ID | 8214 |
| mRNA Refseq | NM_005675 |
| Protein Refseq | NP_005666 |
| MIM | 601279 |
| UniProt ID | Q14129 |
| ◆ Recombinant Proteins | ||
| DGCR6-11756Z | Recombinant Zebrafish DGCR6 | +Inquiry |
| DGCR6-1267H | Recombinant Human DGCR6 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| DGCR6-4540M | Recombinant Mouse DGCR6 Protein | +Inquiry |
| DGCR6-2493HF | Recombinant Full Length Human DGCR6 Protein, GST-tagged | +Inquiry |
| DGCR6-7535H | Recombinant Human DGCR6, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DGCR6-467HCL | Recombinant Human DGCR6 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DGCR6 Products
Required fields are marked with *
My Review for All DGCR6 Products
Required fields are marked with *
