Recombinant Full Length Human DHDH Protein, GST-tagged
| Cat.No. : | DHDH-2525HF |
| Product Overview : | Human DHDH full-length ORF ( NP_055290.1, 1 a.a. - 334 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 334 amino acids |
| Description : | This gene encodes an enzyme that belongs to the family of dihydrodiol dehydrogenases, which exist in multiple forms in mammalian tissues and are involved in the metabolism of xenobiotics and sugars. These enzymes catalyze the NADP1-linked oxidation of transdihydrodiols of aromatic hydrocarbons to corresponding catechols. This enzyme is a dimeric dihydrodiol dehydrogenase, and it differs from monomeric dihydrodiol dehydrogenases in its high substrate specificity for trans-dihydrodiols of aromatic hydrocarbons in the oxidative direction. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 62.8 kDa |
| AA Sequence : | MALRWGIVSVGLISSDFTAVLQTLPRSEHQVVAVAARDLSRAKEFAQKHDIPKAYGSYEELAKDPSVEVAYIGTQHPQHKAAVMLCLAAGKAVLCEKPTGVNAAEVREMVAEARSRALFLMEAIWTRFFPASEALRSVLAQGTLGDLRVARAEFGKNLIHVPRAVDRAQAGGALLDIGIYCVQFTSMVFGGQKPEKISVVGRRHETGVDDTVTVLLQYPGEVHGSFTCSITVQLSNTASVSGTKGMVQLLNPCWCPTELVVKGEHKEFPLPPVPKDCNFDNGAGMSYEAKHVWECLRKGMKESPVIPLSESELLADILEEVRKAIGVTFPQDKR |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | DHDH dihydrodiol dehydrogenase (dimeric) [ Homo sapiens ] |
| Official Symbol | DHDH |
| Synonyms | DHDH; dihydrodiol dehydrogenase (dimeric); trans-1,2-dihydrobenzene-1,2-diol dehydrogenase; HUM2DD; D-xylose 1-dehydrogenase; 3-deoxyglucosone reductase; D-xylose-NADP dehydrogenase; 2DD; |
| Gene ID | 27294 |
| mRNA Refseq | NM_014475 |
| Protein Refseq | NP_055290 |
| MIM | 606377 |
| UniProt ID | Q9UQ10 |
| ◆ Recombinant Proteins | ||
| DHDH-2353M | Recombinant Mouse DHDH Protein, His (Fc)-Avi-tagged | +Inquiry |
| DHDH-2584H | Recombinant Human DHDH Protein, GST-tagged | +Inquiry |
| DHDH-2525HF | Recombinant Full Length Human DHDH Protein, GST-tagged | +Inquiry |
| DHDH-11965H | Recombinant Human DHDH, His-tagged | +Inquiry |
| DHDH-4938H | Recombinant Human DHDH protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DHDH-468HCL | Recombinant Human DHDH cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DHDH Products
Required fields are marked with *
My Review for All DHDH Products
Required fields are marked with *
