Recombinant Full Length Human DIABLO Protein, GST-tagged

Cat.No. : DIABLO-2557HF
Product Overview : Human DIABLO full-length ORF (BAG50903.1, 1 a.a. - 186 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 186 amino acids
Description : This gene encodes an inhibitor of apoptosis protein (IAP)-binding protein. The encoded mitochondrial protein enters the cytosol when cells undergo apoptosis, and allows activation of caspases by binding to inhibitor of apoptosis proteins. Overexpression of the encoded protein sensitizes tumor cells to apoptosis. A mutation in this gene is associated with young-adult onset of nonsyndromic deafness-64. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, May 2013]
Molecular Mass : 47.6 kDa
AA Sequence : MKSDFYFQKSEPHSLSSEALMRRAVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLTSLYRQYTSLLGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITARNHIQLVKLQVEEVHQLSRKAETKLAEAQIEELRQKTQEEGEERAESEQEAYLRED
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DIABLO diablo, IAP-binding mitochondrial protein [ Homo sapiens ]
Official Symbol DIABLO
Synonyms DIABLO; diablo, IAP-binding mitochondrial protein; diablo homolog, mitochondrial; DFNA64; DIABLO S; FLJ10537; FLJ25049; second mitochondria derived activator of caspase; SMAC; 0610041G12Rik; mitochondrial Smac protein; direct IAP-binding protein with low pI; second mitochondria-derived activator of caspase; SMAC3; DIABLO-S;
Gene ID 56616
mRNA Refseq NM_019887
Protein Refseq NP_063940
MIM 605219
UniProt ID Q9NR28

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DIABLO Products

Required fields are marked with *

My Review for All DIABLO Products

Required fields are marked with *

0
cart-icon
0
compare icon