Recombinant Full Length Human DKK4 Protein, GST-tagged
Cat.No. : | DKK4-3952HF |
Product Overview : | Human DKK4 full-length ORF ( NP_055235.1, 1 a.a. - 224 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 224 amino acids |
Description : | This gene encodes a protein that is a member of the dickkopf family. The secreted protein contains two cysteine rich regions and is involved in embryonic development through its interactions with the Wnt signaling pathway. Activity of this protein is modulated by binding to the Wnt co-receptor and the co-factor kremen 2. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 51.3 kDa |
AA Sequence : | MVAAVLLGLSWLCSPLGALVLDFNNIRSSADLHGARKGSQCLSDTDCNTRKFCLQPRDEKPFCATCRGLRRRCQRDAMCCPGTLCVNDVCTTMEDATPILERQLDEQDGTHAEGTTGHPVQENQPKRKPSIKKSQGRKGQEGESCLRTFDCGPGLCCARHFWTKICKPVLLEGQVCSRRGHKDTAQAPEIFQRCDCGPGLLCRSQLTSNRQHARLRVCQKIEKL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DKK4 dickkopf homolog 4 (Xenopus laevis) [ Homo sapiens ] |
Official Symbol | DKK4 |
Synonyms | DKK4; dickkopf homolog 4 (Xenopus laevis); dickkopf (Xenopus laevis) homolog 4; dickkopf-related protein 4; hDkk-4; dickkopf-4; DKK-4; MGC129562; MGC129563; |
Gene ID | 27121 |
mRNA Refseq | NM_014420 |
Protein Refseq | NP_055235 |
MIM | 605417 |
UniProt ID | Q9UBT3 |
◆ Recombinant Proteins | ||
Dkk4-1523M | Recombinant Mouse Dkk4 protein, His & GST-tagged | +Inquiry |
Dkk4-404M | Active Recombinant Mouse Dickkopf Homolog 4 (Xenopus laevis), His-tagged | +Inquiry |
DKK4-2085H | Recombinant Human DKK4 Protein (Gln107-His212), N-His tagged | +Inquiry |
DKK4-1522H | Recombinant Human DKK4 protein, His & T7-tagged | +Inquiry |
DKK4-2800H | Recombinant Human DKK4 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DKK4-6915HCL | Recombinant Human DKK4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DKK4 Products
Required fields are marked with *
My Review for All DKK4 Products
Required fields are marked with *