Recombinant Full Length Human DKK4 Protein, GST-tagged

Cat.No. : DKK4-3952HF
Product Overview : Human DKK4 full-length ORF ( NP_055235.1, 1 a.a. - 224 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 224 amino acids
Description : This gene encodes a protein that is a member of the dickkopf family. The secreted protein contains two cysteine rich regions and is involved in embryonic development through its interactions with the Wnt signaling pathway. Activity of this protein is modulated by binding to the Wnt co-receptor and the co-factor kremen 2. [provided by RefSeq, Jul 2008]
Molecular Mass : 51.3 kDa
AA Sequence : MVAAVLLGLSWLCSPLGALVLDFNNIRSSADLHGARKGSQCLSDTDCNTRKFCLQPRDEKPFCATCRGLRRRCQRDAMCCPGTLCVNDVCTTMEDATPILERQLDEQDGTHAEGTTGHPVQENQPKRKPSIKKSQGRKGQEGESCLRTFDCGPGLCCARHFWTKICKPVLLEGQVCSRRGHKDTAQAPEIFQRCDCGPGLLCRSQLTSNRQHARLRVCQKIEKL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DKK4 dickkopf homolog 4 (Xenopus laevis) [ Homo sapiens ]
Official Symbol DKK4
Synonyms DKK4; dickkopf homolog 4 (Xenopus laevis); dickkopf (Xenopus laevis) homolog 4; dickkopf-related protein 4; hDkk-4; dickkopf-4; DKK-4; MGC129562; MGC129563;
Gene ID 27121
mRNA Refseq NM_014420
Protein Refseq NP_055235
MIM 605417
UniProt ID Q9UBT3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DKK4 Products

Required fields are marked with *

My Review for All DKK4 Products

Required fields are marked with *

0
cart-icon