Recombinant Full Length Human DLD Protein, C-Flag-tagged
Cat.No. : | DLD-1358HFL |
Product Overview : | Recombinant Full Length Human DLD Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the class-I pyridine nucleotide-disulfide oxidoreductase family. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. In homodimeric form, the encoded protein functions as a dehydrogenase and is found in several multi-enzyme complexes that regulate energy metabolism. However, as a monomer, this protein can function as a protease. Mutations in this gene have been identified in patients with E3-deficient maple syrup urine disease and lipoamide dehydrogenase deficiency. Alternative splicing results in multiple transcript variants. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 50.1 kDa |
AA Sequence : | MQSWSRVYCSLAKRGHFNRISHGLQGLSAVPLRTYADQPIDADVTVIGSGPGGYVAAIKAAQLGFKTVCI EKNETLGGTCLNVGCIPSKALLNNSHYYHMAHGKDFASRGIEMSEVRLNLDKMMEQKSTAVKALTGGIAH LFKQNKVVHVNGYGKITGKNQVTATKADGGTQVIDTKNILIATGSEVTPFPGITIDEDTIVSSTGALSLK KVPEKMVVIGAGVIGVELGSVWQRLGADVTAVEFLGHVGGVGIDMEISKNFQRILQKQGFKFKLNTKVTG ATKKSDGKIDVSIEAASGGKAEVITCDVLLVCIGRRPFTKNLGLEELGIELDPRGRIPVNTRFQTKIPNI YAIGDVVAGPMLAHKAEDEGIICVEGMAGGAVHIDYNCVPSVIYTHPEVAWVGKSEEQLKEEGIEYKVGK FPFAANSRAKTNADTDGMVKILGQKSTDRVLGAHILGPGAGEMVNEAALALEYGASCEDIARVCHAHPTL SEAFREANLAASFGKSINFTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Citrate cycle (TCA cycle), Glycine, serine and threonine metabolism, Glycolysis / Gluconeogenesis, Metabolic pathways, Pyruvate metabolism, Valine, leucine and isoleucine degradation |
Full Length : | Full L. |
Gene Name | DLD dihydrolipoamide dehydrogenase [ Homo sapiens (human) ] |
Official Symbol | DLD |
Synonyms | E3; LAD; DLDD; DLDH; GCSL; PHE3; OGDC-E3 |
Gene ID | 1738 |
mRNA Refseq | NM_000108.5 |
Protein Refseq | NP_000099.2 |
MIM | 238331 |
UniProt ID | P09622 |
◆ Recombinant Proteins | ||
DLD-1968H | Recombinant Human DLD Protein (Lys283-His487), N-His tagged | +Inquiry |
DLD-2036H | Recombinant Human Dihydrolipoamide Dehydrogenase, His-tagged | +Inquiry |
DLD-004H | Recombinant Human dihydrolipoamide dehydrogenase Protein, His&Twin Strep tagged | +Inquiry |
DLD-29956TH | Recombinant Human DLD, His-tagged | +Inquiry |
DLD-12017H | Recombinant Human DLD, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DLD-6912HCL | Recombinant Human DLD 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DLD Products
Required fields are marked with *
My Review for All DLD Products
Required fields are marked with *
0
Inquiry Basket