Recombinant Full Length Human DLX2 Protein, GST-tagged
Cat.No. : | DLX2-4002HF |
Product Overview : | Human DLX2 full-length ORF ( AAH32558, 1 a.a. - 328 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 328 amino acids |
Description : | Many vertebrate homeo box-containing genes have been identified on the basis of their sequence similarity with Drosophila developmental genes. Members of the Dlx gene family contain a homeobox that is related to that of Distal-less (Dll), a gene expressed in the head and limbs of the developing fruit fly. The Distal-less (Dlx) family of genes comprises at least 6 different members, DLX1-DLX6. The DLX proteins are postulated to play a role in forebrain and craniofacial development. This gene is located in a tail-to-tail configuration with another member of the gene family on the long arm of chromosome 2. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 61.82 kDa |
AA Sequence : | MTGVFDSLVADMHSTQIAASSTYHQHQQPPSGGGAGPGGNSSSSSSLHKPQESPTLPVSTATDSSYYTNQQHPAGGGGGGGSPYAHMGSYQYQASGLNNVPYSAKSSYDLGYTAAYTSYAPYGTSSSPANNEPEKEDLEPEIRIVNGKPKKVRKPRTIYSSFQLAALQRRFQKTQYLALPERAELAASLGLTQTQVKIWFQNRRSKFKKMWKSGEIPSEQHPGASASPPCASPPVSAPASWDFGVPQRMAGGGGPGSGGSGAGSSGSSPSSAASAFLGNYPWYHQTSGSASHLQATAPLLHPTQTPQPHHHHHHHGGGGAPVSAGTIF |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DLX2 distal-less homeobox 2 [ Homo sapiens ] |
Official Symbol | DLX2 |
Synonyms | DLX2; distal-less homeobox 2; distal less homeo box 2; homeobox protein DLX-2; TES 1; distal-less homeo box 2; TES1; TES-1; |
Gene ID | 1746 |
mRNA Refseq | NM_004405 |
Protein Refseq | NP_004396 |
MIM | 126255 |
UniProt ID | Q07687 |
◆ Recombinant Proteins | ||
DLX2-2691H | Recombinant Human DLX2 Protein, GST-tagged | +Inquiry |
DLX2-4635M | Recombinant Mouse DLX2 Protein | +Inquiry |
DLX2-4002HF | Recombinant Full Length Human DLX2 Protein, GST-tagged | +Inquiry |
DLX2-2404M | Recombinant Mouse DLX2 Protein, His (Fc)-Avi-tagged | +Inquiry |
DLX2-282H | Recombinant Human DLX2 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DLX2-6907HCL | Recombinant Human DLX2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DLX2 Products
Required fields are marked with *
My Review for All DLX2 Products
Required fields are marked with *