Recombinant Full Length Human DMTN Protein, C-Flag-tagged
| Cat.No. : | DMTN-1675HFL |
| Product Overview : | Recombinant Full Length Human DMTN Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Mammalian Cells |
| Tag : | Flag |
| Description : | The protein encoded by this gene is an actin binding and bundling protein that plays a structural role in erythrocytes, by stabilizing and attaching the spectrin/actin cytoskeleton to the erythrocyte membrane in a phosphorylation-dependent manner. This protein contains a core domain in the N-terminus, and a headpiece domain in the C-terminus that binds F-actin. When purified from erythrocytes, this protein exists as a trimer composed of two 48 kDa polypeptides and a 52 kDa polypeptide. The different subunits arise from alternative splicing in the 3' coding region, where the headpiece domain is located. Disruption of this gene has been correlated with the autosomal dominant Marie Unna hereditary hypotrichosis disease, while loss of heterozygosity of this gene is thought to play a role in prostate cancer progression. Alternative splicing results in multiple transcript variants encoding different isoforms. |
| Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
| Molecular Mass : | 45.3 kDa |
| AA Sequence : | MERLQKQPLTSPGSVSPSRDSSVPGSPSSIVAKMDNQVLGYKDLAAIPKDKAILDIERPDLMIYEPHFTY SLLEHVELPRSRERSLSPKSTSPPPSPEVWADSRSPGIISQASAPRTTGTPRTSLPHFHHPETSRPDSNI YKKPPIYKQRESVGGSPQTKHLIEDLIIESSKFPAAQPPDPNQPAKIETDYWPCPPSLAVVETEWRKRKA SRRGAEEEEEEEDDDSGEEMKALRERQREELSKVTSNLGKMILKEEMEKSLPIRRKTRSLPDRTPFHTSL HQGTSKSSSLPAYGRTTLSRLQSTEFSPSGSETGSPGLQNGEGQRGRMDRGNSLPCVLEQKIYPYEMLVV TNKGRTKLPPGVDRMRLERHLSAEDFSRVFAMSPEEFGKLALWKRNELKKKASLFTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Storage : | Store at -80 centigrade. |
| Concentration : | >50 ug/mL as determined by microplate BCA method. |
| Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Full Length : | Full L. |
| Gene Name | DMTN dematin actin binding protein [ Homo sapiens (human) ] |
| Official Symbol | DMTN |
| Synonyms | DMT; EPB49 |
| Gene ID | 2039 |
| mRNA Refseq | NM_001978.5 |
| Protein Refseq | NP_001969.2 |
| MIM | 125305 |
| UniProt ID | Q08495 |
| ◆ Recombinant Proteins | ||
| DMTN-1675HFL | Recombinant Full Length Human DMTN Protein, C-Flag-tagged | +Inquiry |
| DMTN-3793H | Recombinant Human DMTN Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| DMTN-2055H | Recombinant Human DMTN Protein (Met1-Ser269), N-His tagged | +Inquiry |
| DMTN-7924Z | Recombinant Zebrafish DMTN | +Inquiry |
| Dmtn-951M | Recombinant Mouse Dmtn Protein, MYC/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DMTN Products
Required fields are marked with *
My Review for All DMTN Products
Required fields are marked with *
