Recombinant Full Length Human DNAL1 Protein, GST-tagged

Cat.No. : DNAL1-4027HF
Product Overview : Human DNAL1 full-length ORF ( NP_113615.1, 1 a.a. - 151 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 151 amino acids
Description : This gene encodes an axonemal dynein light chain which functions as a component of the outer dynein arms complex. This complex acts as the molecular motor that provides the force to move cilia in an ATP-dependent manner. The encoded protein is expressed in tissues with motile cilia or flagella and may be involved in the movement of sperm flagella. Alternate splicing results in multiple transcript variants.[provided by RefSeq, Jan 2011]
Molecular Mass : 43.5 kDa
AA Sequence : MDASLSMLANCEKLSLSTNCIEKIANLNGLKNLRILSLGRNNIKNLNGLEAVGDTLEELWISYNFIEKLKGIHIMKKLKILYMSNNLVKDWAEFVKLAELPCLEDLVFVGNPLEEKHSAENNWIEEATKRVPKLKKLDGTPVIKGDEEEDN
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DNAL1 dynein, axonemal, light chain 1 [ Homo sapiens ]
Official Symbol DNAL1
Synonyms axonemal; Axonemal dynein light chain 1; Axonemal dynein light chain; C14orf168; Chromosome 14 open reading frame 168; CILD16; DNAL 1; dnal1; DNAL1_HUMAN; Dynein axonemal light chain 1; Dynein light chain 1; Dynein light chain 1 axonemal; MGC12435;
Gene ID 83544
mRNA Refseq NM_031427
Protein Refseq NM_031427
MIM 610062
UniProt ID Q4LDG9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DNAL1 Products

Required fields are marked with *

My Review for All DNAL1 Products

Required fields are marked with *

0
cart-icon
0
compare icon