Recombinant Full Length Human DNAL1 Protein, GST-tagged
Cat.No. : | DNAL1-4027HF |
Product Overview : | Human DNAL1 full-length ORF ( NP_113615.1, 1 a.a. - 151 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 151 amino acids |
Description : | This gene encodes an axonemal dynein light chain which functions as a component of the outer dynein arms complex. This complex acts as the molecular motor that provides the force to move cilia in an ATP-dependent manner. The encoded protein is expressed in tissues with motile cilia or flagella and may be involved in the movement of sperm flagella. Alternate splicing results in multiple transcript variants.[provided by RefSeq, Jan 2011] |
Molecular Mass : | 43.5 kDa |
AA Sequence : | MDASLSMLANCEKLSLSTNCIEKIANLNGLKNLRILSLGRNNIKNLNGLEAVGDTLEELWISYNFIEKLKGIHIMKKLKILYMSNNLVKDWAEFVKLAELPCLEDLVFVGNPLEEKHSAENNWIEEATKRVPKLKKLDGTPVIKGDEEEDN |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DNAL1 dynein, axonemal, light chain 1 [ Homo sapiens ] |
Official Symbol | DNAL1 |
Synonyms | axonemal; Axonemal dynein light chain 1; Axonemal dynein light chain; C14orf168; Chromosome 14 open reading frame 168; CILD16; DNAL 1; dnal1; DNAL1_HUMAN; Dynein axonemal light chain 1; Dynein light chain 1; Dynein light chain 1 axonemal; MGC12435; |
Gene ID | 83544 |
mRNA Refseq | NM_031427 |
Protein Refseq | NM_031427 |
MIM | 610062 |
UniProt ID | Q4LDG9 |
◆ Recombinant Proteins | ||
DNAL1-4455C | Recombinant Chicken DNAL1 | +Inquiry |
DNAL1-4027HF | Recombinant Full Length Human DNAL1 Protein, GST-tagged | +Inquiry |
DNAL1-892Z | Recombinant Zebrafish DNAL1 | +Inquiry |
DNAL1-12091H | Recombinant Human DNAL1, His-tagged | +Inquiry |
DNAL1-2771H | Recombinant Human DNAL1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DNAL1-228HCL | Recombinant Human DNAL1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DNAL1 Products
Required fields are marked with *
My Review for All DNAL1 Products
Required fields are marked with *