Recombinant Full Length Human DOLPP1 Protein, GST-tagged

Cat.No. : DOLPP1-3949HF
Product Overview : Human DOLPP1 full-length ORF ( NP_065171.2, 1 a.a. - 238 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 238 amino acids
Description : A similar gene has been characterized in mice and encodes dolichyl pyrophosphate (Dol-P-P) phosphatase. This protein dephosphorylates dolichyl pyrophosphate so that it may be re-utilized as a glycosyl carrier lipid by the oligosaccharyltransferase multisubunit complex in the ER. Alternative splicing results in multiple transcript variants and protein isoforms. [provided by RefSeq, Jun 2012]
Molecular Mass : 53.4 kDa
AA Sequence : MAADGQCSLPASWRPVTLTHVEYPAGDLSGHLLAYLSLSPVFVIVGFVTLIIFKRELHTISFLGGLALNEGVNWLIKNVIQEPRPCGGPHTAVGTKYGMPSSHSQFMWFFSVYSFLFLYLRMHQTNNARFLDLLWRHVLSLGLLAVAFLVSYSRVYLLYHTWSQVLYGGIAGGLMAIAWFIFTQEVLTPLFPRIAAWPVSEFFLIRDTSLIPNVLWFEYTVTRAEARNRQRKLGTKLQ
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DOLPP1 dolichyl pyrophosphate phosphatase 1 [ Homo sapiens ]
Official Symbol DOLPP1
Synonyms DOLPP1; dolichyl pyrophosphate phosphatase 1; dolichyldiphosphatase 1; linked to Surfeit genes in Fugu rubripes 2; LSFR2;
Gene ID 57171
mRNA Refseq NM_001135917
Protein Refseq NP_001129389
MIM 614516
UniProt ID Q86YN1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DOLPP1 Products

Required fields are marked with *

My Review for All DOLPP1 Products

Required fields are marked with *

0
cart-icon