Recombinant Human DOLPP1 Protein, GST-tagged
| Cat.No. : | DOLPP1-2818H |
| Product Overview : | Human DOLPP1 full-length ORF ( NP_065171.2, 1 a.a. - 238 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | A similar gene has been characterized in mice and encodes dolichyl pyrophosphate (Dol-P-P) phosphatase. This protein dephosphorylates dolichyl pyrophosphate so that it may be re-utilized as a glycosyl carrier lipid by the oligosaccharyltransferase multisubunit complex in the ER. Alternative splicing results in multiple transcript variants and protein isoforms. [provided by RefSeq, Jun 2012] |
| Molecular Mass : | 53.4 kDa |
| AA Sequence : | MAADGQCSLPASWRPVTLTHVEYPAGDLSGHLLAYLSLSPVFVIVGFVTLIIFKRELHTISFLGGLALNEGVNWLIKNVIQEPRPCGGPHTAVGTKYGMPSSHSQFMWFFSVYSFLFLYLRMHQTNNARFLDLLWRHVLSLGLLAVAFLVSYSRVYLLYHTWSQVLYGGIAGGLMAIAWFIFTQEVLTPLFPRIAAWPVSEFFLIRDTSLIPNVLWFEYTVTRAEARNRQRKLGTKLQ |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | DOLPP1 dolichyl pyrophosphate phosphatase 1 [ Homo sapiens ] |
| Official Symbol | DOLPP1 |
| Synonyms | DOLPP1; dolichyl pyrophosphate phosphatase 1; dolichyldiphosphatase 1; linked to Surfeit genes in Fugu rubripes 2; LSFR2; |
| Gene ID | 57171 |
| mRNA Refseq | NM_001135917 |
| Protein Refseq | NP_001129389 |
| MIM | 614516 |
| UniProt ID | Q86YN1 |
| ◆ Cell & Tissue Lysates | ||
| DOLPP1-231HCL | Recombinant Human DOLPP1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DOLPP1 Products
Required fields are marked with *
My Review for All DOLPP1 Products
Required fields are marked with *
