Recombinant Full Length Human DOM3Z Protein, GST-tagged
Cat.No. : | DOM3Z-3951HF |
Product Overview : | Human DOM3Z full-length ORF ( NP_005501.2, 1 a.a. - 396 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 396 amino acids |
Description : | This gene localizes to the major histocompatibility complex (MHC) class III region on chromosome 6. The function of its protein product is unknown, but its ubiquitous expression and conservation in both simple and complex eukaryotes suggests that this may be a housekeeping gene. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 71.3 kDa |
AA Sequence : | MDPRGTKRGAEKTEVAEPRNKLPRPAPSLPTDPALYSGPFPFYRRPSELGCFSLDAQRQYHGDARALRYYSPPPTNGPGPNFDLRDGYPDRYQPRDEEVQERLDHLLCWLLEHRGRLEGGPGWLAEAIVTWRGHLTKLLTTPYERQEGWQLAASRFQGTLYLSEVETPNARAQRLARPPLLRELMYMGYKFEQYMCADKPGSSPDPSGEVNTNVAFCSVLRSRLGSHPLLFSGEVDCTDPQAPSTQPPTCYVELKTSKEMHSPGQWRSFYRHKLLKWWAQSFLPGVPNVVAGFRNPDGFVSSLKTFPTMKMFEYVRNDRDGWNPSVCMNFCAAFLSFAQSTVVQDDPRLVHLFSWEPGGPVTVSVHQDAPYAFLPIWYVEAMTQDLPSPPKTPSPK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DOM3Z dom-3 homolog Z (C. elegans) [ Homo sapiens ] |
Official Symbol | DOM3Z |
Synonyms | DOM3Z; dom-3 homolog Z (C. elegans); DOM 3 (C. elegans) homolog Z; protein Dom3Z; NG6; RAI1; DOM3L; |
Gene ID | 1797 |
mRNA Refseq | NM_005510 |
Protein Refseq | NP_005501 |
MIM | 605996 |
UniProt ID | O77932 |
◆ Recombinant Proteins | ||
DOM3Z-1315R | Recombinant Rhesus monkey DOM3Z Protein, His-tagged | +Inquiry |
DOM3Z-2489M | Recombinant Mouse DOM3Z Protein, His (Fc)-Avi-tagged | +Inquiry |
DOM3Z-3951HF | Recombinant Full Length Human DOM3Z Protein, GST-tagged | +Inquiry |
DOM3Z-1933R | Recombinant Rat DOM3Z Protein | +Inquiry |
DOM3Z-4769M | Recombinant Mouse DOM3Z Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DOM3Z Products
Required fields are marked with *
My Review for All DOM3Z Products
Required fields are marked with *
0
Inquiry Basket