Recombinant Full Length Human DPCR1 Protein, GST-tagged
Cat.No. : | DPCR1-4008HF |
Product Overview : | Human DPCR1 full-length ORF ( NP_543146.1, 1 a.a. - 235 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 235 amino acids |
Description : | DPCR1 (Diffuse Panbronchiolitis Critical Region 1) is a Protein Coding gene. Diseases associated with DPCR1 include Panbronchiolitis, Diffuse. |
Molecular Mass : | 52.1 kDa |
AA Sequence : | MTQVTEKSTEHPEKTTSTTEKTTRTPEKPTLYSEKTICTKGKNTPVPEKPTENLGNTTLTTETIKAPVKSTENPEKTAAVTKTIKPSVKVTGDKSLTTTSSHLNKTEVTHQVPTGSFTLITSRTKLSSITSEATGNESHPYLNKDGSQKGIHAGQMGENDSFPAWAIVIVVLVAVILLLVFLGLIFLVSYMMRTRRTLTQNTQYNDAEDEGGPNSYPVYLMEQQNLGMGQIPSPR |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DPCR1 diffuse panbronchiolitis critical region 1 [ Homo sapiens ] |
Official Symbol | DPCR1 |
Synonyms | DPCR1; diffuse panbronchiolitis critical region 1; diffuse panbronchiolitis critical region protein 1; bCX105N19.6; PBLT; MGC126710; MGC126712; |
Gene ID | 135656 |
mRNA Refseq | NM_080870 |
Protein Refseq | NP_543146 |
MIM | 613928 |
UniProt ID | Q3MIW9 |
◆ Recombinant Proteins | ||
DPCR1-1594R | Recombinant Rat DPCR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
DPCR1-2494M | Recombinant Mouse DPCR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
DPCR1-1142R | Recombinant Rhesus Macaque DPCR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
DPCR1-2823H | Recombinant Human DPCR1 Protein, GST-tagged | +Inquiry |
DPCR1-1317R | Recombinant Rhesus monkey DPCR1 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DPCR1 Products
Required fields are marked with *
My Review for All DPCR1 Products
Required fields are marked with *