Recombinant Full Length Human DPT Protein, GST-tagged
Cat.No. : | DPT-4156HF |
Product Overview : | Human DPT full-length ORF ( NP_001928.2, 1 a.a. - 201 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 201 amino acids |
Description : | Dermatopontin is an extracellular matrix protein with possible functions in cell-matrix interactions and matrix assembly. The protein is found in various tissues and many of its tyrosine residues are sulphated. Dermatopontin is postulated to modify the behavior of TGF-beta through interaction with decorin. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 50.4 kDa |
AA Sequence : | MDLSLLWVLLPLVTMAWGQYGDYGYPYQQYHDYSDDGWVNLNRQGFSYQCPQGQVIVAVRSIFSKKEGSDRQWNYACMPTPQSLGEPTECWWEEINRAGMEWYQTCSNNGLVAGFQSRYFESVLDREWQFYCCRYSKRCPYSCWLTTEYPGHYGEEMDMISYNYDYYIRGATTTFSAVERDRQWKFIMCRMTEYDCEFANV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DPT dermatopontin [ Homo sapiens ] |
Official Symbol | DPT |
Synonyms | DPT; dermatopontin; tyrosine-rich acidic matrix protein; TRAMP; |
Gene ID | 1805 |
mRNA Refseq | NM_001937 |
Protein Refseq | NP_001928 |
MIM | 125597 |
UniProt ID | Q07507 |
◆ Recombinant Proteins | ||
DPT-1754HFL | Recombinant Full Length Human DPT Protein, C-Flag-tagged | +Inquiry |
DPT-4804M | Recombinant Mouse DPT Protein | +Inquiry |
DPT-66H | Recombinant Human DPT protein, T7/His-tagged | +Inquiry |
Dpt-2511M | Recombinant Mouse Dpt Protein, His (Fc)-Avi-tagged | +Inquiry |
DPT-1984H | Recombinant Human DPT Protein (Gln19-Val201), C-His and Fc tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DPT-6823HCL | Recombinant Human DPT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DPT Products
Required fields are marked with *
My Review for All DPT Products
Required fields are marked with *
0
Inquiry Basket