Recombinant Full Length Human DPT Protein, GST-tagged

Cat.No. : DPT-4156HF
Product Overview : Human DPT full-length ORF ( NP_001928.2, 1 a.a. - 201 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 201 amino acids
Description : Dermatopontin is an extracellular matrix protein with possible functions in cell-matrix interactions and matrix assembly. The protein is found in various tissues and many of its tyrosine residues are sulphated. Dermatopontin is postulated to modify the behavior of TGF-beta through interaction with decorin. [provided by RefSeq, Jul 2008]
Molecular Mass : 50.4 kDa
AA Sequence : MDLSLLWVLLPLVTMAWGQYGDYGYPYQQYHDYSDDGWVNLNRQGFSYQCPQGQVIVAVRSIFSKKEGSDRQWNYACMPTPQSLGEPTECWWEEINRAGMEWYQTCSNNGLVAGFQSRYFESVLDREWQFYCCRYSKRCPYSCWLTTEYPGHYGEEMDMISYNYDYYIRGATTTFSAVERDRQWKFIMCRMTEYDCEFANV
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DPT dermatopontin [ Homo sapiens ]
Official Symbol DPT
Synonyms DPT; dermatopontin; tyrosine-rich acidic matrix protein; TRAMP;
Gene ID 1805
mRNA Refseq NM_001937
Protein Refseq NP_001928
MIM 125597
UniProt ID Q07507

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DPT Products

Required fields are marked with *

My Review for All DPT Products

Required fields are marked with *

0

Inquiry Basket

cartIcon