Recombinant Full Length Human DPYS Protein, GST-tagged
| Cat.No. : | DPYS-4167HF |
| Product Overview : | Human DPYS full-length ORF ( ADZ15412.1, 1 a.a. - 519 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 519 amino acids |
| Description : | Dihydropyrimidinase catalyzes the conversion of 5,6-dihydrouracil to 3-ureidopropionate in pyrimidine metabolism. Dihydropyrimidinase is expressed at a high level in liver and kidney as a major 2.5-kb transcript and a minor 3.8-kb transcript. Defects in the DPYS gene are linked to dihydropyrimidinuria. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 57.1 kDa |
| AA Sequence : | MAAPSRLLIRGGRVVNDDFSEVADVLVEDGVVRALGHDLLPPGGAPAGLRVLDAAGKLVLPGGIDTHTHMQFPFMGSRSIDDFHQGTKAALSGGTTMIIDFAIPQKGGSLIEAFETWRSWADPKVCCDYSLHVAVTWWSDQVKEEMKILVQDKGVNSFKMFMAYKDLYMVTDLELYEAFSRCKEIGAIAQVHAENGDLIAEGAKKMLALGITGPEGHELCRPEAVEAEATLRAITIASAVNCPLYIVHVMSKSAAKVIADARRDGKVVYGEPIAASLGTDGTHYWNKEWHHAAHHVMGPPLRPDPSTPDFLMNLLANDDLTTTGTDNCTFNTCQKALGKDDFTKIPNGVNGVEDRMSVIWEKGVHSGKMDENRFVAVTSTNAAKIFNLYPRKGRIAVGSDADIVIWDPKGTRTISAKTHHQAVNFNIFEGMVCHGVPLVTISRGKVVYEAGVFSVTAGDGKFIPRKPFAEYIYKRIKQRDRTCTPTPVERAPYKGEVATLKSRVTKEDATAGTRKQAHP |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | DPYS dihydropyrimidinase [ Homo sapiens ] |
| Official Symbol | DPYS |
| Synonyms | DPYS; dihydropyrimidinase; DHPase; hydantoinase; dihydropyrimidine amidohydrolase; DHP; |
| Gene ID | 1807 |
| mRNA Refseq | NM_001385 |
| Protein Refseq | NP_001376 |
| MIM | 613326 |
| UniProt ID | Q14117 |
| ◆ Recombinant Proteins | ||
| DPYS-4811M | Recombinant Mouse DPYS Protein | +Inquiry |
| DPYS-4829C | Recombinant Chicken DPYS | +Inquiry |
| DPYS-0254H | Recombinant Human DPYS protein, His&GST-tagged | +Inquiry |
| DPYS-2519M | Recombinant Mouse DPYS Protein, His (Fc)-Avi-tagged | +Inquiry |
| DPYS-4167HF | Recombinant Full Length Human DPYS Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DPYS-001HCL | Recombinant Human DPYS cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DPYS Products
Required fields are marked with *
My Review for All DPYS Products
Required fields are marked with *
