Recombinant Full Length Human DPYSL5 Protein, C-Flag-tagged
Cat.No. : | DPYSL5-291HFL |
Product Overview : | Recombinant Full Length Human DPYSL5 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the CRMP (collapsing response mediator protein) family thought to be involved in neural development. Antibodies to the encoded protein were found in some patients with neurologic symptoms who had paraneoplastic syndrome. A pseudogene of this gene is found on chromosome 11. Multiple alternatively spliced variants, encoding the same protein, have been identified. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 61.2 kDa |
AA Sequence : | MLANSASVRILIKGGKVVNDDCTHEADVYIENGIIQQVGRELMIPGGAKVIDATGKLVIPGGIDTSTHFH QTFMNATCVDDFYHGTKAALVGGTTMIIGHVLPDKETSLVDAYEKCRGLADPKVCCDYALHVGITWWAPK VKAEMETLVREKGVNSFQMFMTYKDLYMLRDSELYQVLHACKDIGAIARVHAENGELVAEGAKEALDLGI TGPEGIEISRPEELEAEATHRVITIANRTHCPIYLVNVSSISAGDVIAAAKMQGKVVLAETTTAHATLTG LHYYHQDWSHAAAYVTVPPLRLDTNTSTYLMSLLANDTLNIVASDHRPFTTKQKAMGKEDFTKIPHGVSG VQDRMSVIWERGVVGGKMDENRFVAVTSSNAAKLLNLYPRKGRIIPGADADVVVWDPEATKTISASTQVQ GGDFNLYENMRCHGVPLVTISRGRVVYENGVFMCAEGTGKFCPLRSFPDTVYKKLVQREKTLKVRGVDRT PYLGDVAVVVHPGKKEMGTPLADTPTRPVTRHGGMRDLHESSFSLSGSQIDDHVPKRASARILAPPGGRS SGIWTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Pathways : | Axon guidance |
Full Length : | Full L. |
Gene Name | DPYSL5 dihydropyrimidinase like 5 [ Homo sapiens (human) ] |
Official Symbol | DPYSL5 |
Synonyms | CV2; CRAM; CRMP5; RTSC4; Ulip6; CRMP-5 |
Gene ID | 56896 |
mRNA Refseq | NM_020134.4 |
Protein Refseq | NP_064519.2 |
MIM | 608383 |
UniProt ID | Q9BPU6 |
◆ Recombinant Proteins | ||
DPYSL5-1276H | Recombinant Human DPYSL5 protein, His-tagged | +Inquiry |
DPYSL5-1721H | Recombinant Human DPYSL5 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Dpysl5-2654M | Recombinant Mouse Dpysl5 Protein, Myc/DDK-tagged | +Inquiry |
DPYSL5-2521M | Recombinant Mouse DPYSL5 Protein, His (Fc)-Avi-tagged | +Inquiry |
DPYSL5-2868H | Recombinant Human DPYSL5 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DPYSL5-509HCL | Recombinant Human DPYSL5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DPYSL5 Products
Required fields are marked with *
My Review for All DPYSL5 Products
Required fields are marked with *
0
Inquiry Basket