Recombinant Full Length Human DRG1 Protein, GST-tagged

Cat.No. : DRG1-4193HF
Product Overview : Human DRG1 full-length ORF ( AAH19285, 1 a.a. - 367 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 367 amino acids
Description : DRG1 (Developmentally Regulated GTP Binding Protein 1) is a Protein Coding gene. GO annotations related to this gene include identical protein binding and transcription factor binding.
Molecular Mass : 66.11 kDa
AA Sequence : MSSTLAKIAEIEAEMARTQKNKATAHHLGLLKARLAKLRRELITPKGGGGGGPGEGFDVAKTGDARIGFVGFPSVGKSTLLSNLAGVYSEVAAYEFTTLTTVPGVIRYKGAKIQLLDLPGIIEGAKDGKGRGRQVIAVARTCNLILIVLDVLKPLGHKKIIENELEGFGIRLNSKPPNIGVKKKDKGGINLTATCPQSELDAETVKSILAEYKIHNADVTLRSDATADDLIDVVEGNRVYIPCIYVLNKIDQISIEELDIIYKVPHCVPISAHHRWNFDDLLEKIWDYLKLVRIYTKPKGQLPDYTSPVVLPYSRTTVEDFCMKIHKNLIKEFKYALVWGLSVKHNPQKVGKDHTLEDEDVIQIVKK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DRG1 developmentally regulated GTP binding protein 1 [ Homo sapiens ]
Official Symbol DRG1
Synonyms developmentally regulated GTP binding protein 1; 3029; Ensembl:ENSG00000185721; DKFZp434N1827; developmentally-regulated GTP-binding protein 1;DRG-1;NEDD-3;developmentally regulated GTP-binding protein 1;neural precursor cell expressed, developmentally down-regulated 3;neural precursor cell expressed developmentally down-regulated protein 3; NEDD3
Gene ID 4733
mRNA Refseq NM_004147
Protein Refseq NP_004138
MIM 603952
UniProt ID Q9Y295

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DRG1 Products

Required fields are marked with *

My Review for All DRG1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon