Recombinant Full Length Human DRG1 Protein, GST-tagged
Cat.No. : | DRG1-4193HF |
Product Overview : | Human DRG1 full-length ORF ( AAH19285, 1 a.a. - 367 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 367 amino acids |
Description : | DRG1 (Developmentally Regulated GTP Binding Protein 1) is a Protein Coding gene. GO annotations related to this gene include identical protein binding and transcription factor binding. |
Molecular Mass : | 66.11 kDa |
AA Sequence : | MSSTLAKIAEIEAEMARTQKNKATAHHLGLLKARLAKLRRELITPKGGGGGGPGEGFDVAKTGDARIGFVGFPSVGKSTLLSNLAGVYSEVAAYEFTTLTTVPGVIRYKGAKIQLLDLPGIIEGAKDGKGRGRQVIAVARTCNLILIVLDVLKPLGHKKIIENELEGFGIRLNSKPPNIGVKKKDKGGINLTATCPQSELDAETVKSILAEYKIHNADVTLRSDATADDLIDVVEGNRVYIPCIYVLNKIDQISIEELDIIYKVPHCVPISAHHRWNFDDLLEKIWDYLKLVRIYTKPKGQLPDYTSPVVLPYSRTTVEDFCMKIHKNLIKEFKYALVWGLSVKHNPQKVGKDHTLEDEDVIQIVKK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DRG1 developmentally regulated GTP binding protein 1 [ Homo sapiens ] |
Official Symbol | DRG1 |
Synonyms | developmentally regulated GTP binding protein 1; 3029; Ensembl:ENSG00000185721; DKFZp434N1827; developmentally-regulated GTP-binding protein 1;DRG-1;NEDD-3;developmentally regulated GTP-binding protein 1;neural precursor cell expressed, developmentally down-regulated 3;neural precursor cell expressed developmentally down-regulated protein 3; NEDD3 |
Gene ID | 4733 |
mRNA Refseq | NM_004147 |
Protein Refseq | NP_004138 |
MIM | 603952 |
UniProt ID | Q9Y295 |
◆ Recombinant Proteins | ||
DRG1-2530M | Recombinant Mouse DRG1 Protein, His (Fc)-Avi-tagged | +Inquiry |
DRG1-3876H | Recombinant Human DRG1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Drg1-2661M | Recombinant Mouse Drg1 Protein, Myc/DDK-tagged | +Inquiry |
DRG1-1156R | Recombinant Rhesus Macaque DRG1 Protein, His (Fc)-Avi-tagged | +Inquiry |
DRG1-3256C | Recombinant Chicken DRG1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
DRG1-6815HCL | Recombinant Human DRG1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DRG1 Products
Required fields are marked with *
My Review for All DRG1 Products
Required fields are marked with *