Recombinant Full Length Human DTNB Protein, GST-tagged
Cat.No. : | DTNB-4061HF |
Product Overview : | Human DTNB full-length ORF ( AAH16655.1, 1 a.a. - 560 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 560 amino acids |
Description : | This gene encodes dystrobrevin beta, a component of the dystrophin-associated protein complex (DPC). The DPC consists of dystrophin and several integral and peripheral membrane proteins, including dystroglycans, sarcoglycans, syntrophins and dystrobrevin alpha and beta. The DPC localizes to the sarcolemma and its disruption is associated with various forms of muscular dystrophy. Dystrobrevin beta is thought to interact with syntrophin and the DP71 short form of dystrophin. [provided by RefSeq, Mar 2016] |
Molecular Mass : | 87.23 kDa |
AA Sequence : | MIEESGNKRKTMAEKRQLFIEMRAQNFDVIRLSTYRTACKLRFVQKRCNLHLVDIWNMIEAFRDNGLNTLDHTTEISVSRLETVISSIYYQLNKRLPSTHQISVEQSISLLLNFMIAAYDSEGRGKLTVFSVKAMLATMCGGKMLDKLRYVFSQMSDSNGLMIFSKFDQFLKEVLKLPTAVFEGPSFGYTEHSVRTCFPQQRKIMLNMFLDTMMADPPPQCLVWLPLMHRLAHVENVFHPVECSYCRCESMMGFRYRCQQCHNYQLCQNCFWRGHAGGPHSNQHQMKEHSSWKSPAKKLSHAISKSLGCVPTREPPHPVFPEQPEKPLDLAHIVPPRPLTNMNDTMVSHMSSGVPTPTKSVLDSPSRLDEEHRLIARYAARLAAEAGNVTRPPTDLSFNFDANKQQRQLIAELENKNREILQEIQRLRLEHEQASQPTPEKAQQNPTLLAELRLLRQRKDELEQRMSALQESRRELMVQLEELMKLLKAQATGSPHTSPTHGGGRPMPMPVRSTSAGSTPTHCPQDSLSGVGGDVQEAFAQAEEGAEEEEEKMQNGKDRG |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DTNB dystrobrevin, beta [ Homo sapiens ] |
Official Symbol | DTNB |
Synonyms | DTNB; dystrobrevin, beta; dystrobrevin beta; DTN-B; beta-dystrobrevin; MGC17163; MGC57126; |
Gene ID | 1838 |
mRNA Refseq | NM_001256303 |
Protein Refseq | NP_001243232 |
MIM | 602415 |
UniProt ID | O60941 |
◆ Recombinant Proteins | ||
DTNB-4061HF | Recombinant Full Length Human DTNB Protein, GST-tagged | +Inquiry |
DTNB-1624R | Recombinant Rat DTNB Protein, His (Fc)-Avi-tagged | +Inquiry |
DTNB-2900H | Recombinant Human DTNB Protein, GST-tagged | +Inquiry |
DTNB-12188H | Recombinant Human DTNB, GST-tagged | +Inquiry |
DTNB-1146H | Recombinant Human DTNB Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
DTNB-6798HCL | Recombinant Human DTNB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DTNB Products
Required fields are marked with *
My Review for All DTNB Products
Required fields are marked with *
0
Inquiry Basket