Recombinant Full Length Human DUOX1 Protein, GST-tagged

• Cat.No.: DUOX1-4083HF
• Product Overview: Human DUOX1 partial ORF ( NP_059130, 941 a.a. - 1028 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 941-1028 amino acids
• Description: The protein encoded by this gene is a glycoprotein and a member of the NADPH oxidase family. The synthesis of thyroid hormone is catalyzed by a protein complex located at the apical membrane of thyroid follicular cells. This complex contains an iodide transporter, thyroperoxidase, and a peroxide generating system that includes proteins encoded by this gene and the similar DUOX2 gene. This protein is known as dual oxidase because it has both a peroxidase homology domain and a gp91phox domain. This protein generates hydrogen peroxide and thereby plays a role in the activity of thyroid peroxidase, lactoperoxidase, and in lactoperoxidase-mediated antimicrobial defense at mucosal surfaces. Two alternatively spliced transcript variants encoding the same protein have been described for this gene. [provided by RefSeq, Jul 2012]
• Molecular Mass: 35.42 kDa
• AA Sequence: VEVPEVIKDLCRRASYISQDMICPSPRVSARCSRSDIETELTPQRLQCPMDTDPPQEIRRRFGKKVTSFQPLLFTEAHREKFQRSCLH
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DUOX1 dual oxidase 1 [ Homo sapiens ]
• Official Symbol: DUOX1
• Synonyms: DUOX1; dual oxidase 1; flavoprotein NADPH oxidase; LNOX1; NADPH thyroid oxidase 1; nicotinamide adenine dinucleotide phosphate oxidase; NOXEF1; THOX1; long NOX 1; large NOX 1; thyroid oxidase 1; MGC138840; MGC138841
• Gene ID: 53905
• mRNA Refseq: NM_017434
• Protein Refseq: NP_059130
• MIM: 606758
• UniProt ID: Q9NRD9