Recombinant Human DUOX1 Protein, GST-tagged
Cat.No. : | DUOX1-2915H |
Product Overview : | Human DUOX1 partial ORF ( NP_059130, 941 a.a. - 1028 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a glycoprotein and a member of the NADPH oxidase family. The synthesis of thyroid hormone is catalyzed by a protein complex located at the apical membrane of thyroid follicular cells. This complex contains an iodide transporter, thyroperoxidase, and a peroxide generating system that includes proteins encoded by this gene and the similar DUOX2 gene. This protein is known as dual oxidase because it has both a peroxidase homology domain and a gp91phox domain. This protein generates hydrogen peroxide and thereby plays a role in the activity of thyroid peroxidase, lactoperoxidase, and in lactoperoxidase-mediated antimicrobial defense at mucosal surfaces. Two alternatively spliced transcript variants encoding the same protein have been described for this gene. [provided by RefSeq, Jul 2012] |
Molecular Mass : | 35.42 kDa |
AA Sequence : | VEVPEVIKDLCRRASYISQDMICPSPRVSARCSRSDIETELTPQRLQCPMDTDPPQEIRRRFGKKVTSFQPLLFTEAHREKFQRSCLH |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DUOX1 dual oxidase 1 [ Homo sapiens ] |
Official Symbol | DUOX1 |
Synonyms | DUOX1; dual oxidase 1; flavoprotein NADPH oxidase; LNOX1; NADPH thyroid oxidase 1; nicotinamide adenine dinucleotide phosphate oxidase; NOXEF1; THOX1; long NOX 1; large NOX 1; thyroid oxidase 1; MGC138840; MGC138841; |
Gene ID | 53905 |
mRNA Refseq | NM_017434 |
Protein Refseq | NP_059130 |
MIM | 606758 |
UniProt ID | Q9NRD9 |
◆ Recombinant Proteins | ||
DUOX1-4083HF | Recombinant Full Length Human DUOX1 Protein, GST-tagged | +Inquiry |
Duox1-2676M | Recombinant Mouse Duox1 Protein, Myc/DDK-tagged | +Inquiry |
DUOX1-2713H | Recombinant Human DUOX1 Protein, MYC/DDK-tagged | +Inquiry |
DUOX1-2915H | Recombinant Human DUOX1 Protein, GST-tagged | +Inquiry |
DUOX1-1627R | Recombinant Rat DUOX1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DUOX1 Products
Required fields are marked with *
My Review for All DUOX1 Products
Required fields are marked with *