Recombinant Human DUOX1 Protein, GST-tagged

Cat.No. : DUOX1-2915H
Product Overview : Human DUOX1 partial ORF ( NP_059130, 941 a.a. - 1028 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is a glycoprotein and a member of the NADPH oxidase family. The synthesis of thyroid hormone is catalyzed by a protein complex located at the apical membrane of thyroid follicular cells. This complex contains an iodide transporter, thyroperoxidase, and a peroxide generating system that includes proteins encoded by this gene and the similar DUOX2 gene. This protein is known as dual oxidase because it has both a peroxidase homology domain and a gp91phox domain. This protein generates hydrogen peroxide and thereby plays a role in the activity of thyroid peroxidase, lactoperoxidase, and in lactoperoxidase-mediated antimicrobial defense at mucosal surfaces. Two alternatively spliced transcript variants encoding the same protein have been described for this gene. [provided by RefSeq, Jul 2012]
Molecular Mass : 35.42 kDa
AA Sequence : VEVPEVIKDLCRRASYISQDMICPSPRVSARCSRSDIETELTPQRLQCPMDTDPPQEIRRRFGKKVTSFQPLLFTEAHREKFQRSCLH
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DUOX1 dual oxidase 1 [ Homo sapiens ]
Official Symbol DUOX1
Synonyms DUOX1; dual oxidase 1; flavoprotein NADPH oxidase; LNOX1; NADPH thyroid oxidase 1; nicotinamide adenine dinucleotide phosphate oxidase; NOXEF1; THOX1; long NOX 1; large NOX 1; thyroid oxidase 1; MGC138840; MGC138841;
Gene ID 53905
mRNA Refseq NM_017434
Protein Refseq NP_059130
MIM 606758
UniProt ID Q9NRD9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DUOX1 Products

Required fields are marked with *

My Review for All DUOX1 Products

Required fields are marked with *

0
cart-icon
0
compare icon