Recombinant Full Length Human DUSP19 Protein, GST-tagged

Cat.No. : DUSP19-4100HF
Product Overview : Human DUSP19 full-length ORF ( AAH35000, 1 a.a. - 217 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 217 amino acids
Description : Dual-specificity phosphatases (DUSPs) constitute a large heterogeneous subgroup of the type I cysteine-based protein-tyrosine phosphatase superfamily. DUSPs are characterized by their ability to dephosphorylate both tyrosine and serine/threonine residues. They have been implicated as major modulators of critical signaling pathways. DUSP19 contains a variation of the consensus DUSP C-terminal catalytic domain, with the last serine residue replaced by alanine, and lacks the N-terminal CH2 domain found in the MKP (mitogen-activated protein kinase phosphatase) class of DUSPs (see MIM 600714) (summary by Patterson et al., 2009 [PubMed 19228121]).[supplied by OMIM, Dec 2009]
Molecular Mass : 49.61 kDa
AA Sequence : MYSLNQEIKAFSRNNLRKQCTRVTTLTGKKIIETWKDARIHVVEEVEPSSGCGCGYVQDLSSDLQVGVIKPWLLLGSQDAAHDLDTLKKNKVTHILNVAYGVENAFLSDFTYKSISILDLPETNILSYFPECFEFIEEAKRKDGVVLVHCNAGVSRAAAIVIGFLMNSEQTSFTSAFSLVKNARPSICPNSGFMEQLRTYQEGKESDKCDRIQENSS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DUSP19 dual specificity phosphatase 19 [ Homo sapiens ]
Official Symbol DUSP19
Synonyms DUSP19; dual specificity phosphatase 19; dual specificity protein phosphatase 19; DUSP17; SKRP1; LMW-DSP3; protein phosphatase SKRP1; dual specificity phosphatase TS-DSP1; SAPK pathway-regulating phosphatase 1; low molecular weight dual specificity phosphatase 3; stress-activated protein kinase pathway-regulating phosphatase 1; LMWDSP3; TS-DSP1; MGC138210;
Gene ID 142679
mRNA Refseq NM_001142314
Protein Refseq NP_001135786
MIM 611437
UniProt ID Q8WTR2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DUSP19 Products

Required fields are marked with *

My Review for All DUSP19 Products

Required fields are marked with *

0
cart-icon
0
compare icon