Recombinant Full Length Human DUSP19 Protein, GST-tagged
Cat.No. : | DUSP19-4100HF |
Product Overview : | Human DUSP19 full-length ORF ( AAH35000, 1 a.a. - 217 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 217 amino acids |
Description : | Dual-specificity phosphatases (DUSPs) constitute a large heterogeneous subgroup of the type I cysteine-based protein-tyrosine phosphatase superfamily. DUSPs are characterized by their ability to dephosphorylate both tyrosine and serine/threonine residues. They have been implicated as major modulators of critical signaling pathways. DUSP19 contains a variation of the consensus DUSP C-terminal catalytic domain, with the last serine residue replaced by alanine, and lacks the N-terminal CH2 domain found in the MKP (mitogen-activated protein kinase phosphatase) class of DUSPs (see MIM 600714) (summary by Patterson et al., 2009 [PubMed 19228121]).[supplied by OMIM, Dec 2009] |
Molecular Mass : | 49.61 kDa |
AA Sequence : | MYSLNQEIKAFSRNNLRKQCTRVTTLTGKKIIETWKDARIHVVEEVEPSSGCGCGYVQDLSSDLQVGVIKPWLLLGSQDAAHDLDTLKKNKVTHILNVAYGVENAFLSDFTYKSISILDLPETNILSYFPECFEFIEEAKRKDGVVLVHCNAGVSRAAAIVIGFLMNSEQTSFTSAFSLVKNARPSICPNSGFMEQLRTYQEGKESDKCDRIQENSS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DUSP19 dual specificity phosphatase 19 [ Homo sapiens ] |
Official Symbol | DUSP19 |
Synonyms | DUSP19; dual specificity phosphatase 19; dual specificity protein phosphatase 19; DUSP17; SKRP1; LMW-DSP3; protein phosphatase SKRP1; dual specificity phosphatase TS-DSP1; SAPK pathway-regulating phosphatase 1; low molecular weight dual specificity phosphatase 3; stress-activated protein kinase pathway-regulating phosphatase 1; LMWDSP3; TS-DSP1; MGC138210; |
Gene ID | 142679 |
mRNA Refseq | NM_001142314 |
Protein Refseq | NP_001135786 |
MIM | 611437 |
UniProt ID | Q8WTR2 |
◆ Recombinant Proteins | ||
Dusp19-2686M | Recombinant Mouse Dusp19 Protein, Myc/DDK-tagged | +Inquiry |
DUSP19-1176R | Recombinant Rhesus Macaque DUSP19 Protein, His (Fc)-Avi-tagged | +Inquiry |
DUSP19-28073TH | Recombinant Human DUSP19, His-tagged | +Inquiry |
DUSP19-1317H | Recombinant Human Dual Specificity Phosphatase 19, His-tagged | +Inquiry |
DUSP19-2932H | Recombinant Human DUSP19 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DUSP19-6779HCL | Recombinant Human DUSP19 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DUSP19 Products
Required fields are marked with *
My Review for All DUSP19 Products
Required fields are marked with *