Recombinant Full Length Human DUSP26 Protein, GST-tagged

Cat.No. : DUSP26-4108HF
Product Overview : Human DUSP26 full-length ORF ( NP_076930.1, 1 a.a. - 211 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 211 amino acids
Description : This gene encodes a member of the tyrosine phosphatase family of proteins and exhibits dual specificity by dephosphorylating tyrosine as well as serine and threonine residues. This gene has been described as both a tumor suppressor and an oncogene depending on the cellular context. This protein may regulate neuronal proliferation and has been implicated in the progression of glioblastoma through its ability to dephosphorylate the p53 tumor suppressor. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2015]
Molecular Mass : 50.3 kDa
AA Sequence : MCPGNWLWASMTFMARFSRSSSRSPVRTRGTLEEMPTVQHPFLNVFELERLLYTGKTACNHADEVWPGLYLGDQDMANNRRELRRLGITHVLNASHSRWRGTPEAYEGLGIRYLGVEAHDSPAFDMSIHFQTAADFIHRALSQPGGKILVHCAVGVSRSATLVLAYLMLYHHLTLVEAIKKVKDHRGIIPNRGFLRQLLALDRRLRQGLEA
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DUSP26 dual specificity phosphatase 26 (putative) [ Homo sapiens ]
Official Symbol DUSP26
Synonyms DUSP26; dual specificity phosphatase 26 (putative); dual specificity protein phosphatase 26; DUSP24; MGC1136; DSP-4; MKP-8; MAP kinase phosphatase 8; dual specificity phosphatase SKRP3; dual-specificity phosphatase SKRP3; mitogen-activated protein kinase phosphatase 8; Novel amplified gene in thyroid anaplastic cancer; low-molecular-mass dual-specificity phosphatase 4; MKP8; LDP-4; NATA1; SKRP3; MGC2627;
Gene ID 78986
mRNA Refseq NM_024025
Protein Refseq NP_076930
MIM 618368
UniProt ID Q9BV47

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DUSP26 Products

Required fields are marked with *

My Review for All DUSP26 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon