Recombinant Full Length Human DUSP26 Protein, GST-tagged
Cat.No. : | DUSP26-4108HF |
Product Overview : | Human DUSP26 full-length ORF ( NP_076930.1, 1 a.a. - 211 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 211 amino acids |
Description : | This gene encodes a member of the tyrosine phosphatase family of proteins and exhibits dual specificity by dephosphorylating tyrosine as well as serine and threonine residues. This gene has been described as both a tumor suppressor and an oncogene depending on the cellular context. This protein may regulate neuronal proliferation and has been implicated in the progression of glioblastoma through its ability to dephosphorylate the p53 tumor suppressor. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2015] |
Molecular Mass : | 50.3 kDa |
AA Sequence : | MCPGNWLWASMTFMARFSRSSSRSPVRTRGTLEEMPTVQHPFLNVFELERLLYTGKTACNHADEVWPGLYLGDQDMANNRRELRRLGITHVLNASHSRWRGTPEAYEGLGIRYLGVEAHDSPAFDMSIHFQTAADFIHRALSQPGGKILVHCAVGVSRSATLVLAYLMLYHHLTLVEAIKKVKDHRGIIPNRGFLRQLLALDRRLRQGLEA |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DUSP26 dual specificity phosphatase 26 (putative) [ Homo sapiens ] |
Official Symbol | DUSP26 |
Synonyms | DUSP26; dual specificity phosphatase 26 (putative); dual specificity protein phosphatase 26; DUSP24; MGC1136; DSP-4; MKP-8; MAP kinase phosphatase 8; dual specificity phosphatase SKRP3; dual-specificity phosphatase SKRP3; mitogen-activated protein kinase phosphatase 8; Novel amplified gene in thyroid anaplastic cancer; low-molecular-mass dual-specificity phosphatase 4; MKP8; LDP-4; NATA1; SKRP3; MGC2627; |
Gene ID | 78986 |
mRNA Refseq | NM_024025 |
Protein Refseq | NP_076930 |
MIM | 618368 |
UniProt ID | Q9BV47 |
◆ Recombinant Proteins | ||
DUSP26-219C | Recombinant Cynomolgus Monkey DUSP26 Protein, His (Fc)-Avi-tagged | +Inquiry |
DUSP26-4108HF | Recombinant Full Length Human DUSP26 Protein, GST-tagged | +Inquiry |
DUSP26-4886M | Recombinant Mouse DUSP26 Protein | +Inquiry |
DUSP26-473C | Recombinant Cynomolgus DUSP26 Protein, His-tagged | +Inquiry |
DUSP26-4788H | Recombinant Human DUSP26 protein, His-SUMO-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DUSP26-6775HCL | Recombinant Human DUSP26 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DUSP26 Products
Required fields are marked with *
My Review for All DUSP26 Products
Required fields are marked with *