Recombinant Full Length Human DUT Protein, GST-tagged
Cat.No. : | DUT-4123HF |
Product Overview : | Human DUT full-length ORF ( NP_001020419.1, 1 a.a. - 252 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 252 amino acids |
Description : | This gene encodes an essential enzyme of nucleotide metabolism. The encoded protein forms a ubiquitous, homotetrameric enzyme that hydrolyzes dUTP to dUMP and pyrophosphate. This reaction serves two cellular purposes: providing a precursor (dUMP) for the synthesis of thymine nucleotides needed for DNA replication, and limiting intracellular pools of dUTP. Elevated levels of dUTP lead to increased incorporation of uracil into DNA, which induces extensive excision repair mediated by uracil glycosylase. This repair process, resulting in the removal and reincorporation of dUTP, is self-defeating and leads to DNA fragmentation and cell death. Alternative splicing of this gene leads to different isoforms that localize to either the mitochondrion or nucleus. A related pseudogene is located on chromosome 19. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 53 kDa |
AA Sequence : | MTPLCPRPALCYHFLTSLLRSAMQNARGARQRAEAAVLSGPGPPLGRAAQHGIPRPLSSAGRLSQGCRGASTVGAAGWKGELPKAGGSPAPGPETPAISPSKRARPAEVGGMQLRFARLSEHATAPTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFGSTGKN |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DUT deoxyuridine triphosphatase [ Homo sapiens ] |
Official Symbol | DUT |
Synonyms | DUT; deoxyuridine triphosphatase; dUTP pyrophosphatase; deoxyuridine 5-triphosphate nucleotidohydrolase, mitochondrial; dUTPase; dUTP nucleotidohydrolase; FLJ20622; |
Gene ID | 1854 |
mRNA Refseq | NM_001025248 |
Protein Refseq | NP_001020419 |
MIM | 601266 |
UniProt ID | P33316 |
◆ Recombinant Proteins | ||
DUT-76H | Recombinant Human DUT protein, GST-tagged | +Inquiry |
Dut-449M | Recombinant Mouse Dut Protein, MYC/DDK-tagged | +Inquiry |
DUT-77H | Recombinant Human DUT protein, His-tagged | +Inquiry |
DUT-791H | Recombinant Human DUT protein, His-tagged | +Inquiry |
DUT-4123HF | Recombinant Full Length Human DUT Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DUT-6768HCL | Recombinant Human DUT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DUT Products
Required fields are marked with *
My Review for All DUT Products
Required fields are marked with *