Recombinant Full Length Human DYRK4 Protein, GST-tagged
Cat.No. : | DYRK4-4093HF |
Product Overview : | Human DYRK4 full-length ORF ( NP_003836.1, 1 a.a. - 520 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 520 amino acids |
Description : | This gene encodes an enzyme that belongs to a conserved family of serine/threonine protein kinases. Members of this dual specificity kinase family are thought to function in the regulation of cell differentiation and proliferation, survival, and in development. Alternate splicing results in multiple transcript variants. Additional alternatively spliced transcript variants of this gene have been described, but their full-length nature is not known. [provided by RefSeq, Aug 2013] |
Molecular Mass : | 86 kDa |
AA Sequence : | MPASELKASEIPFHPSIKTQDPKAEEKSPKKQKVTLTAAEALKLFKNQLSPYEQSEILGYAELWFLGLEAKKLDTAPEKFSKTSFDDEHGFYLKVLHDHIAYRYEVLETIGKGSFGQVAKCLDHKNNELVALKIIRNKKRFHQQALMELKILEALRKKDKDNTYNVVHMKDFFYFRNHFCITFELLGINLYELMKNNNFQGFSLSIVRRFTLSVLKCLQMLSVEKIIHCDLKPENIVLYQKGQASVKVIDFGSSCYEHQKVYTYIQSRFYRSPEVILGHPYDVAIDMWSLGCITAELYTGYPLFPGENEVEQLACIMEVLGLPPAGFIQTASRRQTFFDSKGFPKNITNNRGKKRYPDSKDLTMVLKTYDTSFLDFLRRCLVWEPSLRMTPDQALKHAWIHQSRNLKPQPRPQTLRKSNSFFPSETRKDKVQGCHHSSRKADEITKETTEKTKDSPTKHVQHSGDQQDCLQHGADTVQLPQLVDAPKKSEAAVGAEVSMTSPGQSKNFSLKNTNVLPPIV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DYRK4 dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 4 [ Homo sapiens ] |
Official Symbol | DYRK4 |
Synonyms | DYRK4; dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 4; dual specificity tyrosine-phosphorylation-regulated kinase 4; |
Gene ID | 8798 |
mRNA Refseq | NM_003845 |
Protein Refseq | NP_003836 |
MIM | 609181 |
UniProt ID | Q9NR20 |
◆ Recombinant Proteins | ||
DYRK4-4093HF | Recombinant Full Length Human DYRK4 Protein, GST-tagged | +Inquiry |
DYRK4-2992H | Active Recombinant Human DYRK4 Protein, Flag-tagged | +Inquiry |
DYRK4-0846H | Recombinant Human DYRK4 Protein (M1-V520), His/Flag tagged | +Inquiry |
DYRK4-12240H | Recombinant Human DYRK4, His-tagged | +Inquiry |
DYRK4-0845H | Recombinant Human DYRK4 Protein (M1-V520), Tag Free | +Inquiry |
◆ Cell & Tissue Lysates | ||
DYRK4-6749HCL | Recombinant Human DYRK4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DYRK4 Products
Required fields are marked with *
My Review for All DYRK4 Products
Required fields are marked with *