Recombinant Full Length Human E2F2 Protein

Cat.No. : E2F2-133HF
Product Overview : Recombinant full length Human E2F2 with N terminal proprietary tag; Predicted MWt 35.24 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Protein Length : 83 amino acids
Description : The protein encoded by this gene is a member of the E2F family of transcription factors. The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins and is also a target of the transforming proteins of small DNA tumor viruses. The E2F proteins contain several evolutionally conserved domains found in most members of the family. These domains include a DNA binding domain, a dimerization domain which determines interaction with the differentiation regulated transcription factor proteins (DP), a transactivation domain enriched in acidic amino acids, and a tumor suppressor protein association domain which is embedded within the transactivation domain. This protein and another 2 members, E2F1 and E2F3, have an additional cyclin binding domain. This protein binds specifically to retinoblastoma protein pRB in a cell-cycle dependent manner, and it exhibits overall 46% amino acid identity to E2F1.
Form : Liquid
Molecular Mass : 35.240kDa inclusive of tags
AA Sequence : MESRSVAQAGVQWPDLGSLQPLPPRFKRFFCLSLQSSWDYRHAPPRPANFVFLVETGFCHVSQAGLELLTSSDPPPRPPKVLR
Purity : Proprietary Purification
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
Storage Buffer : pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.
Gene Name E2F2 E2F transcription factor 2 [ Homo sapiens ]
Official Symbol E2F2
Synonyms E2F2; E2F transcription factor 2; transcription factor E2F2
Gene ID 1870
mRNA Refseq NM_004091
Protein Refseq NP_004082
MIM 600426
UniProt ID Q14209

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All E2F2 Products

Required fields are marked with *

My Review for All E2F2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon