Recombinant Full Length Human EAF1 Protein, GST-tagged
Cat.No. : | EAF1-4121HF |
Product Overview : | Human EAF1 full-length ORF ( AAH41329, 1 a.a. - 268 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 268 amino acids |
Description : | EAF1 (ELL Associated Factor 1) is a Protein Coding gene. Diseases associated with EAF1 include Eaf. Among its related pathways are Gene Expression and Formation of HIV elongation complex in the absence of HIV Tat. An important paralog of this gene is EAF2. |
Molecular Mass : | 55.22 kDa |
AA Sequence : | MNGTANPLLDREEHCLRLGESFEKRPRASFHTIRYDFKPASIDTSCEGELQVGKGDEVTITLPHIPGSTPPMTVFKGNKRPYQKDCVLIINHDTGEFVLEKLSSSIQVKKTRAEGSSKIQARMEQQPTRPPQTSQPPPPPPPMPFRAPTKPPVGPKTSPLKDNPSPEPQLDDIKRELRAEVDIIEQMSSSSGSSSSDSESSSGSDDDSSSSGGEDNGPASPPQPSHQQPYNSRPAVANGTSRPQGSNQLMNALRNDLQLSESGSDSDD |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | EAF1 ELL associated factor 1 [ Homo sapiens ] |
Official Symbol | EAF1 |
Synonyms | EAF1; ELL associated factor 1; ELL-associated factor 1; ELL (eleven nineteen lysine-rich leukemia gene)-associated factor 1; |
Gene ID | 85403 |
mRNA Refseq | NM_033083 |
Protein Refseq | NP_149074 |
MIM | 608315 |
UniProt ID | Q96JC9 |
◆ Recombinant Proteins | ||
EAF1-4939M | Recombinant Mouse EAF1 Protein | +Inquiry |
EAF1-343Z | Recombinant Zebrafish EAF1 | +Inquiry |
EAF1-437H | Recombinant Human ELL associated factor 1, His-tagged | +Inquiry |
EAF1-3013H | Recombinant Human EAF1 Protein, GST-tagged | +Inquiry |
EAF1-6349H | Recombinant Human EAF1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
EAF1-6739HCL | Recombinant Human EAF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EAF1 Products
Required fields are marked with *
My Review for All EAF1 Products
Required fields are marked with *
0
Inquiry Basket