Recombinant Full Length Human EAF2 Protein, GST-tagged
| Cat.No. : | EAF2-4127HF | 
| Product Overview : | Human EAF2 full-length ORF ( NP_060926.2, 1 a.a. - 260 a.a.) recombinant protein with GST-tag at N-terminal. | 
- Specification
 - Gene Information
 - Related Products
 - Download
 
| Species : | Human | 
| Source : | In Vitro Cell Free System | 
| Tag : | GST | 
| Protein Length : | 260 amino acids | 
| Description : | EAF2 (ELL Associated Factor 2) is a Protein Coding gene. Diseases associated with EAF2 include Eaf and Childhood Leukemia. Among its related pathways are Gene Expression and Formation of HIV elongation complex in the absence of HIV Tat. GO annotations related to this gene include RNA polymerase II regulatory region sequence-specific DNA binding and transcriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding. An important paralog of this gene is EAF1. | 
| Molecular Mass : | 55.2 kDa | 
| AA Sequence : | MNSAAGFSHLDRRERVLKLGESFEKQPRCAFHTVRYDFKPASIDTSSEGYLEVGEGEQVTITLPNIEGSTPPVTVFKGSKKPYLKECILIINHDTGECRLEKLSSNITVKKTRVEGSSKIQYRKEQQQQQMWNSARTPNLVKHSPSEDKMSPASPIDDIERELKAEASLMDQMSSCDSSSDSKSSSSSSSEDSSSDSEDEDCKSSTSDTGNCVSGHPTMTQYRIPDIDASHNRFRDNSGLLMNTLRNDLQLSESGSDSDD | 
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array  | 
                                
| Notes : | Best use within three months from the date of receipt of this protein. | 
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. | 
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Gene Name | EAF2 ELL associated factor 2 [ Homo sapiens (human) ] | 
| Official Symbol | EAF2 | 
| Synonyms | EAF2; ELL associated factor 2; ELL Associated Factor 2; Testosterone-Regulated Apoptosis Inducer And Tumor Suppressor Protein; TRAITS; ELL-Associated Factor 2; BM040; U19; ELL-associated factor 2; testosterone-regulated apoptosis inducer and tumor suppressor protein | 
| Gene ID | 55840 | 
| mRNA Refseq | NM_001320041 | 
| Protein Refseq | NP_001306970 | 
| MIM | 607659 | 
| UniProt ID | Q96CJ1 | 
| ◆ Recombinant Proteins | ||
| EAF2-1652R | Recombinant Rat EAF2 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| Eaf2-298M | Recombinant Mouse Eaf2 Protein, MYC/DDK-tagged | +Inquiry | 
| EAF2-386Z | Recombinant Zebrafish EAF2 | +Inquiry | 
| EAF2-3014H | Recombinant Human EAF2 Protein, GST-tagged | +Inquiry | 
| EAF2-1370R | Recombinant Rhesus monkey EAF2 Protein, His-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| EAF2-523HCL | Recombinant Human EAF2 cell lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
 - Q&As (0)
 
Ask a Question for All EAF2 Products
Required fields are marked with *
My Review for All EAF2 Products
Required fields are marked with *
  
        
    
      
            