Recombinant Full Length Human EDIL3 Protein, GST-tagged
| Cat.No. : | EDIL3-4190HF |
| Product Overview : | Human EDIL3 full-length ORF ( NP_005702.3, 1 a.a. - 480 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 480 amino acids |
| Description : | The protein encoded by this gene is an integrin ligand. It plays an important role in mediating angiogenesis and may be important in vessel wall remodeling and development. It also influences endothelial cell behavior. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 80.2 kDa |
| AA Sequence : | MKRSVAVWLLVGLSLGVPQFGKGDICDPNPCENGGICLPGLADGSFSCECPDGFTDPNCSSVVEVASDEEEPTSAGPCTPNPCHNGGTCEISEAYRGDTFIGYVCKCPRGFNGIHCQHNINECEVEPCKNGGICTDLVANYSCECPGEFMGRNCQYKCSGPLGIEGGIISNQQITASSTHRALFGLQKWYPYYARLNKKGLINAWTAAENDRWPWIQINLQRKMRVTGVITQGAKRIGSPEYIKSYKIAYSNDGKTWAMYKVKGTNEDMVFRGNIDNNTPYANSFTPPIKAQYVRLYPQVCRRHCTLRMELLGCELSGCSEPLGMKSGHIQDYQITASSIFRTLNMDMFTWEPRKARLDKQGKVNAWTSGHNDQSQWLQVDLLVPTKVTGIITQGAKDFGHVQFVGSYKLAYSNDGEHWTVYQDEKQRKDKVFQGNFDNDTHRKNVIDPPIYARHIRILPWSWYGRITLRSELLGCTEEE |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | EDIL3 EGF-like repeats and discoidin I-like domains 3 [ Homo sapiens ] |
| Official Symbol | EDIL3 |
| Synonyms | EDIL3; EGF-like repeats and discoidin I-like domains 3; EGF-like repeat and discoidin I-like domain-containing protein 3; DEL1; integrin-binding protein DEL1; developmental endothelial locus-1; developmentally-regulated endothelial cell locus 1 protein; MGC26287; |
| Gene ID | 10085 |
| mRNA Refseq | NM_005711 |
| Protein Refseq | NP_005702 |
| MIM | 606018 |
| UniProt ID | O43854 |
| ◆ Recombinant Proteins | ||
| Edil3-2728M | Recombinant Mouse Edil3 Protein, Myc/DDK-tagged | +Inquiry |
| EDIL3-1403H | Recombinant Human EDIL3 Protein, His-tagged | +Inquiry |
| EDIL3-4046H | Recombinant Human EDIL3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| EDIL3-5257H | Recombinant Human EDIL3 Protein, His-tagged | +Inquiry |
| EDIL3-3053H | Recombinant Human EDIL3 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| EDIL3-6722HCL | Recombinant Human EDIL3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EDIL3 Products
Required fields are marked with *
My Review for All EDIL3 Products
Required fields are marked with *
