Recombinant Human EDIL3 protein(24-480aa), His-tagged

• Cat.No.: EDIL3-3827H
• Product Overview: Recombinant Human EDIL3 protein(O43854)(24-480aa), fused with C-terminal His tag, was expressed in Insect Cells.

Specification

• Species: Human
• Source: Insect Cells
• Tag: His
• Protein Length: 24-480aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 57.0 kDa
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: DICDPNPCENGGICLPGLADGSFSCECPDGFTDPNCSSVVEVASDEEEPTSAGPCTPNPCHNGGTCEISEAYRGDTFIGYVCKCPRGFNGIHCQHNINECEVEPCKNGGICTDLVANYSCECPGEFMGRNCQYKCSGPLGIEGGIISNQQITASSTHRALFGLQKWYPYYARLNKKGLINAWTAAENDRWPWIQINLQRKMRVTGVITQGAKRIGSPEYIKSYKIAYSNDGKTWAMYKVKGTNEDMVFRGNIDNNTPYANSFTPPIKAQYVRLYPQVCRRHCTLRMELLGCELSGCSEPLGMKSGHIQDYQITASSIFRTLNMDMFTWEPRKARLDKQGKVNAWTSGHNDQSQWLQVDLLVPTKVTGIITQGAKDFGHVQFVGSYKLAYSNDGEHWTVYQDEKQRKDKVFQGNFDNDTHRKNVIDPPIYARHIRILPWSWYGRITLRSELLGCTEEE

Gene Information

• Gene Name: EDIL3 EGF-like repeats and discoidin I-like domains 3 [ Homo sapiens ]
• Official Symbol: EDIL3
• Synonyms: EDIL3; EGF-like repeats and discoidin I-like domains 3; EGF-like repeat and discoidin I-like domain-containing protein 3; DEL1; integrin-binding protein DEL1; developmental endothelial locus-1; developmentally-regulated endothelial cell locus 1 protein; MGC26287
• Gene ID: 10085
• mRNA Refseq: NM_005711
• Protein Refseq: NP_005702
• MIM: 606018
• UniProt ID: O43854