Recombinant Human EDIL3 protein(24-480aa), His-tagged
Cat.No. : | EDIL3-3827H |
Product Overview : | Recombinant Human EDIL3 protein(O43854)(24-480aa), fused with C-terminal His tag, was expressed in Insect Cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Insect Cells |
Tag : | His |
Protein Length : | 24-480aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 57.0 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | DICDPNPCENGGICLPGLADGSFSCECPDGFTDPNCSSVVEVASDEEEPTSAGPCTPNPCHNGGTCEISEAYRGDTFIGYVCKCPRGFNGIHCQHNINECEVEPCKNGGICTDLVANYSCECPGEFMGRNCQYKCSGPLGIEGGIISNQQITASSTHRALFGLQKWYPYYARLNKKGLINAWTAAENDRWPWIQINLQRKMRVTGVITQGAKRIGSPEYIKSYKIAYSNDGKTWAMYKVKGTNEDMVFRGNIDNNTPYANSFTPPIKAQYVRLYPQVCRRHCTLRMELLGCELSGCSEPLGMKSGHIQDYQITASSIFRTLNMDMFTWEPRKARLDKQGKVNAWTSGHNDQSQWLQVDLLVPTKVTGIITQGAKDFGHVQFVGSYKLAYSNDGEHWTVYQDEKQRKDKVFQGNFDNDTHRKNVIDPPIYARHIRILPWSWYGRITLRSELLGCTEEE |
Gene Name | EDIL3 EGF-like repeats and discoidin I-like domains 3 [ Homo sapiens ] |
Official Symbol | EDIL3 |
Synonyms | EDIL3; EGF-like repeats and discoidin I-like domains 3; EGF-like repeat and discoidin I-like domain-containing protein 3; DEL1; integrin-binding protein DEL1; developmental endothelial locus-1; developmentally-regulated endothelial cell locus 1 protein; MGC26287; |
Gene ID | 10085 |
mRNA Refseq | NM_005711 |
Protein Refseq | NP_005702 |
MIM | 606018 |
UniProt ID | O43854 |
◆ Recombinant Proteins | ||
Edil3-2728M | Recombinant Mouse Edil3 Protein, Myc/DDK-tagged | +Inquiry |
EDIL3-4990M | Recombinant Mouse EDIL3 Protein | +Inquiry |
EDIL3-3053H | Recombinant Human EDIL3 Protein, GST-tagged | +Inquiry |
EDIL3-974H | Active Recombinant Human EDIL3 Protein, His-tagged | +Inquiry |
EDIL3-7736H | Recombinant Human EDIL3, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EDIL3-6722HCL | Recombinant Human EDIL3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EDIL3 Products
Required fields are marked with *
My Review for All EDIL3 Products
Required fields are marked with *