Recombinant Full Length Human EFCAB2 Protein, GST-tagged

• Cat.No.: EFCAB2-4223HF
• Product Overview: Human EFCAB2 full-length ORF ( NP_115704.1, 1 a.a. - 162 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 162 amino acids
• Description: The gene encodes a protein that contains two EF-hand calcium-binding domains although its function has yet to be determined. Alternatively spliced transcripts have been observed. [provided by RefSeq, Mar 2014]
• Molecular Mass: 45.3 kDa
• AA Sequence: MADEKDREEIIVAEFHKKIKEAFEVFDHESNNTVDVREIGTIIRSLGCCPTEGELHDLIAEVEEEEPTGYIRFEKFLPVMTEILLERKYRPIPEDVLLRAFEVLDSAKRGFLTKDELIKYMTEEGEPFSQEEMEEMLSAAIDPESNSINYKDYITMMVIDEN
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: EFCAB2 EF-hand calcium binding domain 2 [ Homo sapiens ]
• Official Symbol: EFCAB2
• Synonyms: EFCAB2; EF-hand calcium binding domain 2; EF-hand calcium-binding domain-containing protein 2; MGC12458; FLJ33608
• Gene ID: 84288
• mRNA Refseq: NM_001143943
• Protein Refseq: NP_001137415
• MIM: 619617
• UniProt ID: Q5VUJ9