Recombinant Full Length Human EFCAB2 Protein, GST-tagged

Cat.No. : EFCAB2-4223HF
Product Overview : Human EFCAB2 full-length ORF ( NP_115704.1, 1 a.a. - 162 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 162 amino acids
Description : The gene encodes a protein that contains two EF-hand calcium-binding domains although its function has yet to be determined. Alternatively spliced transcripts have been observed. [provided by RefSeq, Mar 2014]
Molecular Mass : 45.3 kDa
AA Sequence : MADEKDREEIIVAEFHKKIKEAFEVFDHESNNTVDVREIGTIIRSLGCCPTEGELHDLIAEVEEEEPTGYIRFEKFLPVMTEILLERKYRPIPEDVLLRAFEVLDSAKRGFLTKDELIKYMTEEGEPFSQEEMEEMLSAAIDPESNSINYKDYITMMVIDEN
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name EFCAB2 EF-hand calcium binding domain 2 [ Homo sapiens ]
Official Symbol EFCAB2
Synonyms EFCAB2; EF-hand calcium binding domain 2; EF-hand calcium-binding domain-containing protein 2; MGC12458; FLJ33608;
Gene ID 84288
mRNA Refseq NM_001143943
Protein Refseq NP_001137415
MIM 619617
UniProt ID Q5VUJ9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EFCAB2 Products

Required fields are marked with *

My Review for All EFCAB2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon