Recombinant Human EFCAB2 Protein, GST-tagged
Cat.No. : | EFCAB2-3080H |
Product Overview : | Human EFCAB2 full-length ORF ( NP_115704.1, 1 a.a. - 162 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The gene encodes a protein that contains two EF-hand calcium-binding domains although its function has yet to be determined. Alternatively spliced transcripts have been observed. [provided by RefSeq, Mar 2014] |
Molecular Mass : | 45.3 kDa |
AA Sequence : | MADEKDREEIIVAEFHKKIKEAFEVFDHESNNTVDVREIGTIIRSLGCCPTEGELHDLIAEVEEEEPTGYIRFEKFLPVMTEILLERKYRPIPEDVLLRAFEVLDSAKRGFLTKDELIKYMTEEGEPFSQEEMEEMLSAAIDPESNSINYKDYITMMVIDEN |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | EFCAB2 EF-hand calcium binding domain 2 [ Homo sapiens ] |
Official Symbol | EFCAB2 |
Synonyms | EFCAB2; EF-hand calcium binding domain 2; EF-hand calcium-binding domain-containing protein 2; MGC12458; FLJ33608; |
Gene ID | 84288 |
mRNA Refseq | NM_001143943 |
Protein Refseq | NP_001137415 |
UniProt ID | Q5VUJ9 |
◆ Recombinant Proteins | ||
EFCAB2-12299H | Recombinant Human EFCAB2, GST-tagged | +Inquiry |
EFCAB2-1198H | Recombinant Human EFCAB2 Protein, MYC/DDK-tagged | +Inquiry |
EFCAB2-2656M | Recombinant Mouse EFCAB2 Protein, His (Fc)-Avi-tagged | +Inquiry |
EFCAB2-5011M | Recombinant Mouse EFCAB2 Protein | +Inquiry |
EFCAB2-3080H | Recombinant Human EFCAB2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EFCAB2-532HCL | Recombinant Human EFCAB2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EFCAB2 Products
Required fields are marked with *
My Review for All EFCAB2 Products
Required fields are marked with *
0
Inquiry Basket