Recombinant Full Length Human EHD1 Protein, C-Flag-tagged
Cat.No. : | EHD1-1494HFL |
Product Overview : | Recombinant Full Length Human EHD1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene belongs to a highly conserved gene family encoding EPS15 homology (EH) domain-containing proteins. The protein-binding EH domain was first noted in EPS15, a substrate for the epidermal growth factor receptor. The EH domain has been shown to be an important motif in proteins involved in protein-protein interactions and in intracellular sorting. The protein encoded by this gene is thought to play a role in the endocytosis of IGF1 receptors. Alternatively spliced transcript variants have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 60.4 kDa |
AA Sequence : | MFSWVSKDARRKKEPELFQTVAEGLRQLYAQKLLPLEEHYRFHEFHSPALEDADFDNKPMVLLVGQYSTG KTTFIRHLIEQDFPGMRIGPEPTTDSFIAVMHGPTEGVVPGNALVVDPRRPFRKLNAFGNAFLNRFMCAQ LPNPVLDSISIIDTPGILSGEKQRISRGYDFAAVLEWFAERVDRIILLFDAHKLDISDEFSEVIKALKNH EDKIRVVLNKADQIETQQLMRVYGALMWSLGKIINTPEVVRVYIGSFWSHPLLIPDNRKLFEAEEQDLFK DIQSLPRNAALRKLNDLIKRARLAKVHAYIISSLKKEMPNVFGKESKKKELVNNLGEIYQKIEREHQISP GDFPSLRKMQELLQTQDFSKFQALKPKLLDTVDDMLANDIARLMVMVRQEESLMPSQVVKGGAFDGTMNG PFGHGYGEGAGEGIDDVEWVVGKDKPTYDEIFYTLSPVNGKITGANAKKEMVKSKLPNTVLGKIWKLADV DKDGLLDDEEFALANHLIKVKLEGHELPADLPPHLVPPSKRRHESGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Endocytosis |
Full Length : | Full L. |
Gene Name | EHD1 EH domain containing 1 [ Homo sapiens (human) ] |
Official Symbol | EHD1 |
Synonyms | PAST; PAST1; H-PAST; HPAST1 |
Gene ID | 10938 |
mRNA Refseq | NM_006795.4 |
Protein Refseq | NP_006786.2 |
MIM | 605888 |
UniProt ID | Q9H4M9 |
◆ Recombinant Proteins | ||
EHD1-392H | Recombinant Human EHD1 Protein, MYC/DDK-tagged | +Inquiry |
EHD1-1693R | Recombinant Rat EHD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
EHD1-3128H | Recombinant Human EHD1 Protein, GST-tagged | +Inquiry |
EHD1-1402R | Recombinant Rhesus monkey EHD1 Protein, His-tagged | +Inquiry |
EHD1-1494HFL | Recombinant Full Length Human EHD1 Protein, C-Flag-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EHD1 Products
Required fields are marked with *
My Review for All EHD1 Products
Required fields are marked with *
0
Inquiry Basket