Recombinant Full Length Human EIF2A Protein, C-Flag-tagged
Cat.No. : | EIF2A-58HFL |
Product Overview : | Recombinant Full Length Human EIF2A Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a eukaryotic translation initiation factor that catalyzes the formation of puromycin-sensitive 80 S preinitiation complexes and the poly(U)-directed synthesis of polyphenylalanine at low concentrations of Mg2+. This gene should not be confused with eIF2-alpha (EIF2S1, Gene ID: 1965), the alpha subunit of the eIF2 translation initiation complex. Although both of these proteins function in binding initiator tRNA to the 40 S ribosomal subunit, the encoded protein does so in a codon-dependent manner, whereas eIF2 complex requires GTP. Alternative splicing of this gene results in multiple transcript variants encoding different isoforms. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 64.8 kDa |
AA Sequence : | MAPSTPLLTVRGSEGLYMVNGPPHFTESTVFPRESGKNCKVCIFSKDGTLFAWGNGEKVNIISVTNKGLL HSFDLLKAVCLEFSPKNTVLATWQPYTTSKDGTAGIPNLQLYDVKTGTCLKSFIQKKMQNWCPSWSEDET LCARNVNNEVHFFENNNFNTIANKLHLQKINDFVLSPGPQPYKVAVYVPGSKGAPSFVRLYQYPNFAGPH AALANKSFFKADKVTMLWNKKATAVLVIASTDVDKTGASYYGEQTLHYIATNGESAVVQLPKNGPIYDVV WNSSSTEFCAVYGFMPAKATIFNLKCDPVFDFGTGPRNAAYYSPHGHILVLAGFGNLRGQMEVWDVKNYK LISKPVASDSTYFAWCPDGEHILTATCAPRLRVNNGYKIWHYTGSILHKYDVPSNAELWQVSWQPFLDGI FPAKTITYQAVPSEVPNEEPKVATAYRPPALRNKPITNSKLHEEEPPQNMKPQSGNDKPLSKTALKNQRK HEAKKAAKQEARSDKSPDLAPTPAPQSTPRNTVSQSISGDPEIDKKIKNLKKKLKAIEQLKEQAATGKQL EKNQLEKIQKETALLQELEDLKLGITRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | EIF2A eukaryotic translation initiation factor 2A [ Homo sapiens (human) ] |
Official Symbol | EIF2A |
Synonyms | CDA02; EIF-2A; MST089; MSTP004; MSTP089 |
Gene ID | 83939 |
mRNA Refseq | NM_032025.5 |
Protein Refseq | NP_114414.2 |
MIM | 609234 |
UniProt ID | Q9BY44 |
◆ Recombinant Proteins | ||
EIF2A-28490TH | Recombinant Human EIF2A, His-tagged | +Inquiry |
EIF2A-817H | Recombinant Human EIF2A Protein, His (Fc)-Avi-tagged | +Inquiry |
EIF2A-12348H | Recombinant Human EIF2A, GST-tagged | +Inquiry |
EIF2A-2697M | Recombinant Mouse EIF2A Protein, His (Fc)-Avi-tagged | +Inquiry |
EIF2A-4408HF | Recombinant Full Length Human EIF2A Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EIF2A-6675HCL | Recombinant Human EIF2A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EIF2A Products
Required fields are marked with *
My Review for All EIF2A Products
Required fields are marked with *
0
Inquiry Basket