Recombinant Full Length Human EIF2S1 Protein, C-Flag-tagged
Cat.No. : | EIF2S1-262HFL |
Product Overview : | Recombinant Full Length Human EIF2S1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The translation initiation factor EIF2 catalyzes the first regulated step of protein synthesis initiation, promoting the binding of the initiator tRNA to 40S ribosomal subunits. Binding occurs as a ternary complex of methionyl-tRNA, EIF2, and GTP. EIF2 is composed of 3 nonidentical subunits, the 36-kD EIF2-alpha subunit (EIF2S1), the 38-kD EIF2-beta subunit, and the 52-kD EIF2-gamma subunit. The rate of formation of the ternary complex is modulated by the phosphorylation state of EIF2-alpha. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 35.9 kDa |
AA Sequence : | MPGLSCRFYQHKFPEVEDVVMVNVRSIAEMGAYVSLLEYNNIEGMILLSELSRRRIRSINKLIRIGRNEC VVVIRVDKEKGYIDLSKRRVSPEEAIKCEDKFTKSKTVYSILRHVAEVLEYTKDEQLESLFQRTAWVFDD KYKRPGYGAYDAFKHAVSDPSILDSLDLNEDEREVLINNINRRLTPQAVKIRADIEVACYGYEGIDAVKE ALRAGLNCSTENMPIKINLIAPPRYVMTTTTLERTEGLSVLSQAMAVIKEKIEEKRGVFNVQMEPKVVTD TDETELARQMERLERENAEVDGDDDAEEMEAKAEDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | EIF2S1 eukaryotic translation initiation factor 2 subunit alpha [ Homo sapiens (human) ] |
Official Symbol | EIF2S1 |
Synonyms | EIF2; EIF-2; EIF2A; EIF-2A; EIF-2alpha |
Gene ID | 1965 |
mRNA Refseq | NM_004094.5 |
Protein Refseq | NP_004085.1 |
MIM | 603907 |
UniProt ID | P05198 |
◆ Recombinant Proteins | ||
EIF2S1-371H | Recombinant Human EIF2S1 Protein, MYC/DDK-tagged | +Inquiry |
EIF2S1-4186HF | Recombinant Full Length Human EIF2S1 Protein, GST-tagged | +Inquiry |
EIF2S1-1616C | Recombinant Chicken EIF2S1 | +Inquiry |
EIF2S1-262HFL | Recombinant Full Length Human EIF2S1 Protein, C-Flag-tagged | +Inquiry |
EIF2S1-1419R | Recombinant Rhesus monkey EIF2S1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EIF2S1-542HCL | Recombinant Human EIF2S1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EIF2S1 Products
Required fields are marked with *
My Review for All EIF2S1 Products
Required fields are marked with *
0
Inquiry Basket