Recombinant Full Length Human EIF2S3 Protein, GST-tagged

Cat.No. : EIF2S3-4198HF
Product Overview : Human EIF2S3 full-length ORF ( NP_001406.1, 1 a.a. - 472 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 472 amino acids
Description : The protein encoded by this gene is the largest subunit of a heterotrimeric GTP-binding protein involved in the recruitment of methionyl-tRNA(i) to the 40 S ribosomal subunit. [provided by RefSeq, Jan 2010]
Molecular Mass : 77.5 kDa
AA Sequence : MAGGEAGVTLGQPHLSRQDLTTLDVTKLTPLSHEVISRQATINIGTIGHVAHGKSTVVKAISGVHTVRFKNELERNITIKLGYANAKIYKLDDPSCPRPECYRSCGSSTPDEFPTDIPGTKGNFKLVRHVSFVDCPGHDILMATMLNGAAVMDAALLLIAGNESCPQPQTSEHLAAIEIMKLKHILILQNKIDLVKESQAKEQYEQILAFVQGTVAEGAPIIPISAQLKYNIEVVCEYIVKKIPVPPRDFTSEPRLIVIRSFDVNKPGCEVDDLKGGVAGGSILKGVLKVGQEIEVRPGIVSKDSEGKLMCKPIFSKIVSLFAEHNDLQYAAPGGLIGVGTKIDPTLCRADRMVGQVLGAVGALPEIFTELEISYFLLRRLLGVRTEGDKKAAKVQKLSKNEVLMVNIGSLSTGGRVSAVKADLGKIVLTNPVCTEVGEKIALSRRVEKHWRLIGWGQIRRGVTIKPTVDDD
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name EIF2S3 eukaryotic translation initiation factor 2, subunit 3 gamma, 52kDa [ Homo sapiens ]
Official Symbol EIF2S3
Synonyms EIF2S3; eukaryotic translation initiation factor 2, subunit 3 gamma, 52kDa; EIF2G, eukaryotic translation initiation factor 2, subunit 3 (gamma, 52kD); eukaryotic translation initiation factor 2 subunit 3; EIF2; EIF2gamma; eukaryotic translation initiation factor 2G; eIF-2gX; eIF-2-gamma X; eukaryotic translation initiation factor 2 subunit gamma X; EIF2G; eIF-2gA;
Gene ID 1968
mRNA Refseq NM_001415
Protein Refseq NP_001406
MIM 300161
UniProt ID P41091

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EIF2S3 Products

Required fields are marked with *

My Review for All EIF2S3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon